Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D8PL67

Protein Details
Accession D8PL67    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
6-32AGAGTRERERRHRTKWHFGIRSRSPPMBasic
NLS Segment(s)
PositionSequence
9-20GTRERERRHRTK
Subcellular Location(s) mito 13, cyto 8, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR032270  AMPK_C  
IPR028375  KA1/Ssp2_C  
Gene Ontology GO:0005524  F:ATP binding  
Pfam View protein in Pfam  
PF16579  AdenylateSensor  
CDD cd12122  AMPKA_C  
Amino Acid Sequences MSAKRAGAGTRERERRHRTKWHFGIRSRSPPMEVMLEIYRTLKTLGMEWKEKKSLGGLGGVPPRTSSGRAELSRAPELDGVDLKAAAQVYFVETRARVGDVVVLMNLQLYMVDSINYLVDFHHKGSYRASTAEGAGKFDMAPVGEHHHGEVRPCTMLDRKDKDQGAKEDEVVSPFVFMDVACRLILELAGGGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.76
3 0.77
4 0.8
5 0.79
6 0.81
7 0.86
8 0.87
9 0.86
10 0.82
11 0.83
12 0.8
13 0.81
14 0.76
15 0.67
16 0.58
17 0.51
18 0.47
19 0.4
20 0.31
21 0.25
22 0.21
23 0.2
24 0.18
25 0.18
26 0.16
27 0.13
28 0.14
29 0.12
30 0.1
31 0.13
32 0.2
33 0.24
34 0.32
35 0.34
36 0.39
37 0.39
38 0.39
39 0.36
40 0.3
41 0.29
42 0.22
43 0.22
44 0.18
45 0.2
46 0.24
47 0.24
48 0.22
49 0.19
50 0.2
51 0.18
52 0.19
53 0.16
54 0.17
55 0.23
56 0.24
57 0.26
58 0.27
59 0.3
60 0.3
61 0.29
62 0.25
63 0.19
64 0.19
65 0.17
66 0.15
67 0.11
68 0.09
69 0.08
70 0.07
71 0.07
72 0.07
73 0.05
74 0.05
75 0.04
76 0.06
77 0.07
78 0.08
79 0.07
80 0.07
81 0.08
82 0.08
83 0.09
84 0.07
85 0.06
86 0.07
87 0.06
88 0.06
89 0.05
90 0.05
91 0.04
92 0.04
93 0.04
94 0.03
95 0.02
96 0.03
97 0.04
98 0.04
99 0.04
100 0.04
101 0.05
102 0.05
103 0.05
104 0.05
105 0.04
106 0.08
107 0.09
108 0.1
109 0.14
110 0.15
111 0.16
112 0.19
113 0.22
114 0.21
115 0.2
116 0.21
117 0.17
118 0.17
119 0.22
120 0.19
121 0.18
122 0.16
123 0.15
124 0.13
125 0.13
126 0.12
127 0.07
128 0.08
129 0.07
130 0.13
131 0.14
132 0.14
133 0.15
134 0.18
135 0.19
136 0.21
137 0.22
138 0.18
139 0.18
140 0.18
141 0.21
142 0.22
143 0.28
144 0.35
145 0.4
146 0.42
147 0.49
148 0.53
149 0.56
150 0.58
151 0.58
152 0.56
153 0.51
154 0.48
155 0.42
156 0.4
157 0.35
158 0.29
159 0.22
160 0.16
161 0.13
162 0.12
163 0.09
164 0.08
165 0.1
166 0.09
167 0.11
168 0.1
169 0.1
170 0.1
171 0.1
172 0.11
173 0.08