Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D8PLV9

Protein Details
Accession D8PLV9    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
10-36ASSGGKAAKKKKWSKGKVKDKAQHAVAHydrophilic
NLS Segment(s)
PositionSequence
13-30GGKAAKKKKWSKGKVKDK
Subcellular Location(s) nucl 16, mito 8, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG scm:SCHCO_02624592  -  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAKAKATQAASSGGKAAKKKKWSKGKVKDKAQHAVAVDKPLFDRIIKEVPTFRFISQSILIERLKINGSLARVAIRHLEKEGQIKRIVHHSQQLIYTRATASD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.31
3 0.37
4 0.39
5 0.48
6 0.56
7 0.63
8 0.71
9 0.78
10 0.83
11 0.86
12 0.9
13 0.9
14 0.91
15 0.88
16 0.84
17 0.8
18 0.71
19 0.63
20 0.53
21 0.47
22 0.38
23 0.36
24 0.29
25 0.22
26 0.21
27 0.18
28 0.18
29 0.13
30 0.13
31 0.12
32 0.16
33 0.17
34 0.18
35 0.2
36 0.21
37 0.24
38 0.24
39 0.21
40 0.19
41 0.18
42 0.21
43 0.18
44 0.18
45 0.15
46 0.18
47 0.17
48 0.16
49 0.16
50 0.14
51 0.14
52 0.12
53 0.13
54 0.11
55 0.12
56 0.12
57 0.13
58 0.13
59 0.12
60 0.13
61 0.18
62 0.17
63 0.17
64 0.18
65 0.2
66 0.21
67 0.3
68 0.34
69 0.32
70 0.35
71 0.35
72 0.36
73 0.42
74 0.44
75 0.4
76 0.43
77 0.42
78 0.4
79 0.45
80 0.47
81 0.4
82 0.36
83 0.34