Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D8PV60

Protein Details
Accession D8PV60    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
14-36VTRGAGFRKEKNKKKRGSYRGGDBasic
NLS Segment(s)
PositionSequence
20-30FRKEKNKKKRG
Subcellular Location(s) mito 9, nucl 8.5, cyto_nucl 8, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007718  Srp40_C  
Gene Ontology GO:0005730  C:nucleolus  
KEGG scm:SCHCO_02481850  -  
Pfam View protein in Pfam  
PF05022  SRP40_C  
Amino Acid Sequences MSDYGARAHQDLIVTRGAGFRKEKNKKKRGSYRGGDITASGGERRCTIRTLTRLIDGVPQHQVHLSNTEAHTNDGDGRSW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.18
4 0.17
5 0.19
6 0.21
7 0.26
8 0.36
9 0.46
10 0.56
11 0.63
12 0.72
13 0.76
14 0.83
15 0.87
16 0.85
17 0.85
18 0.79
19 0.77
20 0.74
21 0.66
22 0.55
23 0.45
24 0.36
25 0.26
26 0.22
27 0.14
28 0.08
29 0.07
30 0.09
31 0.11
32 0.11
33 0.12
34 0.14
35 0.2
36 0.23
37 0.28
38 0.28
39 0.28
40 0.27
41 0.26
42 0.29
43 0.24
44 0.22
45 0.23
46 0.21
47 0.2
48 0.21
49 0.22
50 0.18
51 0.2
52 0.19
53 0.19
54 0.2
55 0.24
56 0.24
57 0.23
58 0.23
59 0.21
60 0.24