Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D8Q549

Protein Details
Accession D8Q549    Localization Confidence Low Confidence Score 5.9
NoLS Segment(s)
PositionSequenceProtein Nature
89-110YTLFTKKKSEVYKKLRQWRIDMHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, cyto 10, cyto_nucl 7.333, cyto_pero 6.333, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036397  RNaseH_sf  
Gene Ontology GO:0016020  C:membrane  
GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MGHTNFESLRNMVRHGQLGEVDTLTGIPSFCEPCVMGKMKKLPFKRSTTPASRPLQFVSCDVGGPVDPAAIGGYLYWIVIVCHYSSGVYTLFTKKKSEVYKKLRQWRIDMEHQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.28
3 0.29
4 0.24
5 0.24
6 0.22
7 0.18
8 0.15
9 0.11
10 0.1
11 0.09
12 0.08
13 0.06
14 0.05
15 0.07
16 0.08
17 0.08
18 0.09
19 0.09
20 0.11
21 0.16
22 0.2
23 0.19
24 0.23
25 0.31
26 0.36
27 0.43
28 0.46
29 0.49
30 0.52
31 0.58
32 0.6
33 0.57
34 0.59
35 0.59
36 0.6
37 0.59
38 0.56
39 0.51
40 0.46
41 0.42
42 0.37
43 0.3
44 0.25
45 0.2
46 0.15
47 0.14
48 0.12
49 0.11
50 0.08
51 0.08
52 0.07
53 0.04
54 0.03
55 0.04
56 0.04
57 0.03
58 0.03
59 0.03
60 0.03
61 0.03
62 0.03
63 0.03
64 0.03
65 0.03
66 0.04
67 0.05
68 0.05
69 0.05
70 0.06
71 0.06
72 0.06
73 0.08
74 0.08
75 0.08
76 0.11
77 0.18
78 0.22
79 0.24
80 0.26
81 0.27
82 0.34
83 0.44
84 0.51
85 0.55
86 0.61
87 0.7
88 0.77
89 0.85
90 0.86
91 0.81
92 0.77
93 0.76