Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D8PLE5

Protein Details
Accession D8PLE5    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
19-38YTHHHHRRTVRHHKDPAHVTBasic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 10, mito 8, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018824  Conidiation-specific_6  
KEGG scm:SCHCO_02624349  -  
Pfam View protein in Pfam  
PF10346  Con-6  
Amino Acid Sequences MPLFGRRHHATAPSSGGGYTHHHHRRTVRHHKDPAHVTGGYKAALANPNTTSAGRRHAKHELRKRGESTHVPLMVRIKRTLGIRSTPRTYEQSTVGGYGHHTTHGGEYGHSTGGYGHGTTTHGTHHHY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.28
3 0.25
4 0.21
5 0.23
6 0.21
7 0.27
8 0.33
9 0.34
10 0.39
11 0.46
12 0.54
13 0.61
14 0.69
15 0.69
16 0.71
17 0.78
18 0.79
19 0.8
20 0.75
21 0.69
22 0.62
23 0.52
24 0.43
25 0.37
26 0.33
27 0.24
28 0.19
29 0.15
30 0.13
31 0.16
32 0.16
33 0.15
34 0.15
35 0.16
36 0.17
37 0.17
38 0.17
39 0.14
40 0.22
41 0.24
42 0.25
43 0.27
44 0.36
45 0.43
46 0.51
47 0.59
48 0.62
49 0.63
50 0.66
51 0.64
52 0.57
53 0.55
54 0.49
55 0.44
56 0.39
57 0.35
58 0.31
59 0.3
60 0.34
61 0.32
62 0.3
63 0.26
64 0.21
65 0.22
66 0.24
67 0.26
68 0.23
69 0.27
70 0.31
71 0.36
72 0.38
73 0.37
74 0.39
75 0.39
76 0.39
77 0.35
78 0.31
79 0.28
80 0.25
81 0.24
82 0.21
83 0.16
84 0.15
85 0.14
86 0.13
87 0.11
88 0.1
89 0.1
90 0.11
91 0.15
92 0.14
93 0.12
94 0.14
95 0.15
96 0.15
97 0.15
98 0.14
99 0.1
100 0.12
101 0.13
102 0.1
103 0.09
104 0.09
105 0.11
106 0.11
107 0.12
108 0.14