Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D8PPK7

Protein Details
Accession D8PPK7    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
116-147PPTTQSTSKRKARPKAAPAPKRQKTKGKARADHydrophilic
NLS Segment(s)
PositionSequence
123-145SKRKARPKAAPAPKRQKTKGKAR
Subcellular Location(s) nucl 12.5, cyto_nucl 10, mito 8, cyto 6.5
Family & Domain DBs
KEGG scm:SCHCO_02621872  -  
Amino Acid Sequences MPFRARNAYYLKISERNVLPLYVYLDERHLDWMNDQILQHVLADLRPHIVPKLRAEADATQSAAGAKKLTVDTHRGDSYQFAYFLRKTHPHSVLVKTRHFVAAPPVKRTAPASAPPPTTQSTSKRKARPKAAPAPKRQKTKGKARADEDEELAVTSDEEAEDEGAPMPAAPRRSLRARKPALGLYAEDAEDEDMEEDVKPPPAAEPPNPETEEPPQEDVEMSEPSPSPPPPPQPSAFDLAADEEEEKPKPLLQLRYQGFSIYGHCLCVVVEPWPPMRGASLAPGSRAGSVAPSRSGSLAPFHQETSVQPPGTQRARTPLFLPDPDERRSLTPGPRGLTPAPLNARDGSAAPATSRDGSVVPSGRNLPPVPLFGDSNQEPLFLLGDEDEDANVDEDGSGMMALSQALHAAGDLHGTAAEDDEDMDGSIFFGDADEVREL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.45
3 0.45
4 0.42
5 0.38
6 0.33
7 0.28
8 0.3
9 0.24
10 0.24
11 0.19
12 0.2
13 0.2
14 0.19
15 0.22
16 0.21
17 0.19
18 0.19
19 0.24
20 0.23
21 0.25
22 0.24
23 0.2
24 0.2
25 0.19
26 0.18
27 0.14
28 0.13
29 0.11
30 0.13
31 0.12
32 0.14
33 0.14
34 0.15
35 0.17
36 0.23
37 0.27
38 0.3
39 0.38
40 0.36
41 0.37
42 0.4
43 0.4
44 0.39
45 0.37
46 0.33
47 0.23
48 0.22
49 0.23
50 0.2
51 0.16
52 0.12
53 0.1
54 0.13
55 0.14
56 0.18
57 0.2
58 0.24
59 0.27
60 0.32
61 0.33
62 0.3
63 0.29
64 0.29
65 0.28
66 0.25
67 0.22
68 0.18
69 0.21
70 0.22
71 0.24
72 0.28
73 0.31
74 0.35
75 0.43
76 0.46
77 0.47
78 0.51
79 0.57
80 0.59
81 0.59
82 0.57
83 0.49
84 0.47
85 0.43
86 0.38
87 0.31
88 0.32
89 0.35
90 0.35
91 0.38
92 0.39
93 0.37
94 0.38
95 0.39
96 0.34
97 0.3
98 0.3
99 0.31
100 0.34
101 0.37
102 0.36
103 0.38
104 0.35
105 0.33
106 0.35
107 0.38
108 0.42
109 0.48
110 0.56
111 0.61
112 0.68
113 0.74
114 0.79
115 0.8
116 0.8
117 0.82
118 0.84
119 0.84
120 0.86
121 0.88
122 0.85
123 0.85
124 0.82
125 0.81
126 0.79
127 0.81
128 0.81
129 0.8
130 0.79
131 0.74
132 0.75
133 0.7
134 0.63
135 0.53
136 0.43
137 0.33
138 0.26
139 0.22
140 0.13
141 0.08
142 0.06
143 0.05
144 0.04
145 0.04
146 0.04
147 0.04
148 0.05
149 0.05
150 0.05
151 0.05
152 0.05
153 0.05
154 0.06
155 0.07
156 0.09
157 0.1
158 0.12
159 0.16
160 0.25
161 0.33
162 0.4
163 0.48
164 0.51
165 0.54
166 0.55
167 0.53
168 0.47
169 0.4
170 0.33
171 0.24
172 0.21
173 0.17
174 0.13
175 0.11
176 0.08
177 0.07
178 0.06
179 0.05
180 0.04
181 0.04
182 0.04
183 0.05
184 0.06
185 0.07
186 0.06
187 0.06
188 0.07
189 0.11
190 0.13
191 0.14
192 0.21
193 0.23
194 0.27
195 0.29
196 0.28
197 0.26
198 0.27
199 0.29
200 0.24
201 0.23
202 0.18
203 0.17
204 0.17
205 0.15
206 0.14
207 0.1
208 0.09
209 0.08
210 0.08
211 0.09
212 0.11
213 0.11
214 0.12
215 0.15
216 0.21
217 0.24
218 0.28
219 0.29
220 0.31
221 0.33
222 0.35
223 0.32
224 0.25
225 0.21
226 0.18
227 0.16
228 0.12
229 0.11
230 0.07
231 0.09
232 0.09
233 0.09
234 0.09
235 0.1
236 0.12
237 0.17
238 0.22
239 0.24
240 0.33
241 0.34
242 0.36
243 0.35
244 0.32
245 0.28
246 0.23
247 0.21
248 0.16
249 0.15
250 0.12
251 0.12
252 0.12
253 0.11
254 0.11
255 0.1
256 0.07
257 0.09
258 0.11
259 0.12
260 0.13
261 0.13
262 0.12
263 0.12
264 0.11
265 0.1
266 0.11
267 0.15
268 0.15
269 0.16
270 0.17
271 0.17
272 0.16
273 0.16
274 0.12
275 0.11
276 0.12
277 0.13
278 0.13
279 0.13
280 0.13
281 0.14
282 0.14
283 0.12
284 0.13
285 0.14
286 0.16
287 0.17
288 0.16
289 0.16
290 0.16
291 0.17
292 0.21
293 0.25
294 0.21
295 0.21
296 0.23
297 0.3
298 0.34
299 0.34
300 0.28
301 0.31
302 0.34
303 0.35
304 0.34
305 0.34
306 0.34
307 0.34
308 0.37
309 0.35
310 0.37
311 0.38
312 0.38
313 0.32
314 0.3
315 0.34
316 0.35
317 0.34
318 0.37
319 0.38
320 0.39
321 0.39
322 0.41
323 0.36
324 0.38
325 0.33
326 0.33
327 0.33
328 0.32
329 0.33
330 0.29
331 0.29
332 0.23
333 0.22
334 0.18
335 0.15
336 0.14
337 0.12
338 0.13
339 0.14
340 0.14
341 0.14
342 0.12
343 0.11
344 0.13
345 0.18
346 0.19
347 0.18
348 0.2
349 0.24
350 0.24
351 0.28
352 0.27
353 0.25
354 0.24
355 0.26
356 0.25
357 0.23
358 0.24
359 0.2
360 0.27
361 0.24
362 0.27
363 0.25
364 0.23
365 0.2
366 0.19
367 0.19
368 0.12
369 0.12
370 0.07
371 0.08
372 0.08
373 0.08
374 0.08
375 0.07
376 0.08
377 0.08
378 0.08
379 0.07
380 0.06
381 0.06
382 0.06
383 0.05
384 0.04
385 0.04
386 0.04
387 0.04
388 0.04
389 0.04
390 0.04
391 0.04
392 0.05
393 0.05
394 0.05
395 0.05
396 0.06
397 0.06
398 0.06
399 0.06
400 0.07
401 0.07
402 0.07
403 0.07
404 0.07
405 0.06
406 0.07
407 0.07
408 0.08
409 0.07
410 0.08
411 0.07
412 0.06
413 0.06
414 0.06
415 0.05
416 0.05
417 0.06
418 0.06