Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D8QL10

Protein Details
Accession D8QL10    Localization Confidence High Confidence Score 22
NoLS Segment(s)
PositionSequenceProtein Nature
60-83PRSREYAGRRRSRRPSRHPHPDAQBasic
110-130IEYRRRRNTLAARRSRQKKADHydrophilic
NLS Segment(s)
PositionSequence
66-77AGRRRSRRPSRH
114-128RRRNTLAARRSRQKK
Subcellular Location(s) nucl 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF07716  bZIP_2  
PROSITE View protein in PROSITE  
PS50217  BZIP  
PS00036  BZIP_BASIC  
CDD cd12193  bZIP_GCN4  
Amino Acid Sequences MQGLLSDFAFPPTTTTTDAYAATAPRGPSRTLATSHARPPCPAMSTPSDHPAPDAPIQAPRSREYAGRRRSRRPSRHPHPDAQLRFGDDEEDELPEDHPPPAGATDQEKIEYRRRRNTLAARRSRQKKADKMATLEDDVRRLTSERDTWKTRAQTLRQLLLSHGIPCKEFED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.21
4 0.21
5 0.21
6 0.2
7 0.19
8 0.17
9 0.16
10 0.18
11 0.17
12 0.19
13 0.21
14 0.21
15 0.21
16 0.26
17 0.27
18 0.27
19 0.31
20 0.34
21 0.36
22 0.43
23 0.47
24 0.43
25 0.41
26 0.43
27 0.4
28 0.37
29 0.33
30 0.3
31 0.28
32 0.31
33 0.33
34 0.34
35 0.32
36 0.28
37 0.28
38 0.25
39 0.24
40 0.21
41 0.2
42 0.16
43 0.21
44 0.23
45 0.25
46 0.25
47 0.23
48 0.24
49 0.24
50 0.27
51 0.29
52 0.37
53 0.43
54 0.51
55 0.55
56 0.61
57 0.7
58 0.77
59 0.79
60 0.8
61 0.82
62 0.82
63 0.88
64 0.84
65 0.79
66 0.76
67 0.75
68 0.66
69 0.58
70 0.49
71 0.39
72 0.34
73 0.29
74 0.22
75 0.12
76 0.12
77 0.09
78 0.08
79 0.07
80 0.07
81 0.08
82 0.07
83 0.08
84 0.07
85 0.07
86 0.06
87 0.06
88 0.07
89 0.07
90 0.08
91 0.09
92 0.11
93 0.12
94 0.13
95 0.15
96 0.17
97 0.26
98 0.34
99 0.38
100 0.46
101 0.49
102 0.52
103 0.59
104 0.66
105 0.68
106 0.7
107 0.73
108 0.71
109 0.77
110 0.81
111 0.8
112 0.79
113 0.78
114 0.76
115 0.76
116 0.78
117 0.72
118 0.69
119 0.66
120 0.61
121 0.54
122 0.49
123 0.4
124 0.32
125 0.28
126 0.24
127 0.2
128 0.18
129 0.18
130 0.19
131 0.25
132 0.31
133 0.37
134 0.42
135 0.45
136 0.52
137 0.54
138 0.57
139 0.59
140 0.57
141 0.6
142 0.61
143 0.64
144 0.58
145 0.54
146 0.48
147 0.44
148 0.4
149 0.34
150 0.31
151 0.26
152 0.24