Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D8PUT2

Protein Details
Accession D8PUT2    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
157-180GSPQPGQPAKRPRGRPKGSKTKKHBasic
NLS Segment(s)
PositionSequence
153-180VKRPGSPQPGQPAKRPRGRPKGSKTKKH
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018482  Znf-C4H2  
Amino Acid Sequences STSQHPIPANSSEWARDLVQLAKTAELKRHALTLQMHTAHILSAHASLEQKSKMIQDLKEQKNKLESERNRLLNCLREVNEDRDKITHPWSSPLRCTTLRQQIAALTEGEYANAKREVDAIRAELGQAPLPTLQNTIDEKTSQYLTQRRLSGVKRPGSPQPGQPAKRPRGRPKGSKTKKH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.22
3 0.21
4 0.21
5 0.22
6 0.22
7 0.24
8 0.23
9 0.24
10 0.27
11 0.28
12 0.3
13 0.3
14 0.31
15 0.28
16 0.31
17 0.28
18 0.29
19 0.3
20 0.31
21 0.33
22 0.31
23 0.3
24 0.27
25 0.27
26 0.22
27 0.18
28 0.13
29 0.08
30 0.07
31 0.07
32 0.08
33 0.09
34 0.1
35 0.13
36 0.14
37 0.13
38 0.13
39 0.14
40 0.19
41 0.22
42 0.22
43 0.28
44 0.38
45 0.46
46 0.53
47 0.52
48 0.49
49 0.51
50 0.51
51 0.47
52 0.47
53 0.43
54 0.44
55 0.51
56 0.54
57 0.48
58 0.48
59 0.45
60 0.4
61 0.38
62 0.34
63 0.27
64 0.28
65 0.3
66 0.34
67 0.38
68 0.32
69 0.31
70 0.28
71 0.29
72 0.25
73 0.26
74 0.23
75 0.17
76 0.23
77 0.26
78 0.27
79 0.28
80 0.28
81 0.29
82 0.27
83 0.3
84 0.31
85 0.37
86 0.36
87 0.34
88 0.33
89 0.3
90 0.3
91 0.28
92 0.21
93 0.11
94 0.11
95 0.1
96 0.1
97 0.1
98 0.08
99 0.1
100 0.11
101 0.1
102 0.09
103 0.12
104 0.13
105 0.15
106 0.16
107 0.14
108 0.14
109 0.14
110 0.14
111 0.13
112 0.13
113 0.12
114 0.11
115 0.11
116 0.11
117 0.12
118 0.12
119 0.11
120 0.11
121 0.13
122 0.16
123 0.17
124 0.17
125 0.17
126 0.18
127 0.19
128 0.2
129 0.17
130 0.22
131 0.26
132 0.3
133 0.36
134 0.37
135 0.37
136 0.42
137 0.44
138 0.47
139 0.49
140 0.51
141 0.49
142 0.51
143 0.56
144 0.56
145 0.56
146 0.53
147 0.56
148 0.59
149 0.58
150 0.63
151 0.65
152 0.68
153 0.74
154 0.78
155 0.78
156 0.79
157 0.85
158 0.87
159 0.87
160 0.9