Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D8PRY5

Protein Details
Accession D8PRY5    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
42-62IGSIGKKSLRRRKKSLSSSEAHydrophilic
NLS Segment(s)
PositionSequence
45-55IGKKSLRRRKK
Subcellular Location(s) mito 14, nucl 10.5, cyto_nucl 6.5
Family & Domain DBs
Amino Acid Sequences MSLLGKLPFPFSHSSSSSADAPGPSATPERRPSRLHQRLSSIGSIGKKSLRRRKKSLSSSEASSSYHPYAVYYQNMLPLLRDPAVLKTVLESILEMPGGKRMLSRMARTCRALSDPVLNMLWKELDSLIPLLGLFPGSVLKKARKLFW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.3
3 0.33
4 0.31
5 0.28
6 0.27
7 0.21
8 0.2
9 0.16
10 0.15
11 0.13
12 0.17
13 0.18
14 0.23
15 0.31
16 0.35
17 0.4
18 0.43
19 0.5
20 0.56
21 0.63
22 0.64
23 0.6
24 0.61
25 0.6
26 0.6
27 0.53
28 0.42
29 0.36
30 0.31
31 0.28
32 0.23
33 0.23
34 0.26
35 0.34
36 0.44
37 0.51
38 0.57
39 0.64
40 0.73
41 0.78
42 0.82
43 0.81
44 0.78
45 0.71
46 0.66
47 0.6
48 0.51
49 0.42
50 0.33
51 0.27
52 0.2
53 0.18
54 0.14
55 0.12
56 0.14
57 0.15
58 0.15
59 0.13
60 0.13
61 0.14
62 0.15
63 0.14
64 0.11
65 0.1
66 0.11
67 0.1
68 0.1
69 0.09
70 0.09
71 0.11
72 0.11
73 0.09
74 0.08
75 0.09
76 0.09
77 0.08
78 0.07
79 0.06
80 0.07
81 0.07
82 0.06
83 0.05
84 0.08
85 0.09
86 0.09
87 0.08
88 0.09
89 0.17
90 0.21
91 0.27
92 0.32
93 0.39
94 0.43
95 0.45
96 0.45
97 0.4
98 0.39
99 0.36
100 0.3
101 0.29
102 0.25
103 0.25
104 0.25
105 0.22
106 0.19
107 0.18
108 0.16
109 0.11
110 0.11
111 0.09
112 0.09
113 0.1
114 0.11
115 0.1
116 0.09
117 0.09
118 0.08
119 0.08
120 0.07
121 0.05
122 0.05
123 0.09
124 0.1
125 0.14
126 0.19
127 0.25
128 0.32