Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D8PLH5

Protein Details
Accession D8PLH5    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
140-159LARVLDKRAQRKKEKGEEFEBasic
169-191ADDAEKRVKKPRREEPTRSQDIGBasic
NLS Segment(s)
PositionSequence
146-182KRAQRKKEKGEEFELKPNNRKRPADDAEKRVKKPRRE
Subcellular Location(s) mito 15.5, cyto_mito 9.5, nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR039119  ABT1/Esf2  
IPR034353  ABT1/ESF2_RRM  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
Gene Ontology GO:0005730  C:nucleolus  
GO:0003676  F:nucleic acid binding  
KEGG scm:SCHCO_01115578  -  
CDD cd12263  RRM_ABT1_like  
Amino Acid Sequences GIIYISRIPPGMRPAKVRHLMSAYGEVGRVYLQQEDPKRAYLRKKYTSTNKAHFTEGWVEFKDKKIARSVAELLNAQPIGGKKGTRFYDDVWTMKYLPKFKWNMLTEQVAHEAAVHTAKLRAELQQSRSEQREYLKNVELARVLDKRAQRKKEKGEEFELKPNNRKRPADDAEKRVKKPRREEPTRSQDIGDVLSNVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.53
3 0.61
4 0.58
5 0.55
6 0.51
7 0.49
8 0.45
9 0.44
10 0.35
11 0.27
12 0.26
13 0.21
14 0.17
15 0.15
16 0.13
17 0.1
18 0.11
19 0.13
20 0.2
21 0.24
22 0.31
23 0.32
24 0.36
25 0.39
26 0.42
27 0.49
28 0.52
29 0.58
30 0.61
31 0.64
32 0.68
33 0.75
34 0.79
35 0.78
36 0.75
37 0.73
38 0.66
39 0.63
40 0.54
41 0.47
42 0.45
43 0.39
44 0.34
45 0.28
46 0.28
47 0.27
48 0.29
49 0.33
50 0.27
51 0.27
52 0.3
53 0.32
54 0.31
55 0.34
56 0.35
57 0.3
58 0.3
59 0.28
60 0.22
61 0.22
62 0.2
63 0.15
64 0.13
65 0.11
66 0.12
67 0.12
68 0.13
69 0.11
70 0.18
71 0.2
72 0.21
73 0.22
74 0.22
75 0.28
76 0.3
77 0.3
78 0.25
79 0.24
80 0.22
81 0.24
82 0.25
83 0.21
84 0.19
85 0.26
86 0.27
87 0.27
88 0.35
89 0.33
90 0.33
91 0.33
92 0.34
93 0.27
94 0.26
95 0.26
96 0.17
97 0.15
98 0.12
99 0.1
100 0.08
101 0.08
102 0.06
103 0.05
104 0.07
105 0.07
106 0.09
107 0.09
108 0.12
109 0.17
110 0.22
111 0.25
112 0.31
113 0.33
114 0.35
115 0.37
116 0.36
117 0.31
118 0.31
119 0.35
120 0.32
121 0.34
122 0.34
123 0.34
124 0.34
125 0.34
126 0.31
127 0.25
128 0.25
129 0.22
130 0.21
131 0.22
132 0.27
133 0.35
134 0.43
135 0.51
136 0.56
137 0.63
138 0.72
139 0.78
140 0.82
141 0.77
142 0.77
143 0.76
144 0.71
145 0.71
146 0.69
147 0.63
148 0.64
149 0.66
150 0.67
151 0.68
152 0.67
153 0.63
154 0.66
155 0.68
156 0.7
157 0.7
158 0.7
159 0.72
160 0.77
161 0.75
162 0.75
163 0.77
164 0.75
165 0.76
166 0.78
167 0.78
168 0.8
169 0.84
170 0.85
171 0.87
172 0.86
173 0.78
174 0.68
175 0.59
176 0.51
177 0.45
178 0.35