Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4QW04

Protein Details
Accession C4QW04   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
193-219MKERYLKVENKAKKKKKGLWGIERGLTHydrophilic
NLS Segment(s)
PositionSequence
202-211NKAKKKKKGL
Subcellular Location(s) mito 15, nucl 5, cyto 2, extr 2, plas 1, E.R. 1, vacu 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR035437  SNase_OB-fold_sf  
IPR016071  Staphylococal_nuclease_OB-fold  
Gene Ontology GO:0016020  C:membrane  
GO:0005739  C:mitochondrion  
GO:0004519  F:endonuclease activity  
GO:0046872  F:metal ion binding  
KEGG ppa:PAS_chr1-1_0068  -  
Pfam View protein in Pfam  
PF00565  SNase  
PROSITE View protein in PROSITE  
PS50830  TNASE_3  
Amino Acid Sequences MAQSNQHVSIYNPKVIVYSIGLTTAILASMSIYRSHFVRFSTSLDVPKTLFRTKHLHGKVTSVGDGDNFHFYHLPGGIFAGWGWIRETPEINKFRKLKNKTIHVRLCGVDAPERSHFGKPSQPYSEEALQWLRQFILGKKVKVKPLSVDQYNRIVGRVFIFRWNGWNDVSEEMLRNGVAIVYENKSSAEFDGMKERYLKVENKAKKKKKGLWGIERGLTPGEYKRLYK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.27
3 0.27
4 0.19
5 0.16
6 0.13
7 0.13
8 0.13
9 0.12
10 0.12
11 0.1
12 0.07
13 0.05
14 0.05
15 0.05
16 0.07
17 0.08
18 0.09
19 0.1
20 0.11
21 0.12
22 0.15
23 0.16
24 0.15
25 0.2
26 0.2
27 0.23
28 0.28
29 0.3
30 0.32
31 0.32
32 0.32
33 0.27
34 0.29
35 0.31
36 0.3
37 0.28
38 0.29
39 0.34
40 0.37
41 0.46
42 0.46
43 0.47
44 0.43
45 0.45
46 0.45
47 0.41
48 0.38
49 0.28
50 0.24
51 0.18
52 0.19
53 0.16
54 0.15
55 0.12
56 0.12
57 0.13
58 0.12
59 0.13
60 0.13
61 0.11
62 0.08
63 0.09
64 0.08
65 0.07
66 0.07
67 0.08
68 0.07
69 0.07
70 0.08
71 0.09
72 0.1
73 0.11
74 0.13
75 0.13
76 0.22
77 0.27
78 0.29
79 0.35
80 0.38
81 0.43
82 0.51
83 0.55
84 0.56
85 0.57
86 0.66
87 0.66
88 0.72
89 0.7
90 0.63
91 0.6
92 0.51
93 0.44
94 0.35
95 0.28
96 0.22
97 0.18
98 0.18
99 0.16
100 0.18
101 0.19
102 0.18
103 0.18
104 0.17
105 0.22
106 0.21
107 0.26
108 0.26
109 0.26
110 0.27
111 0.3
112 0.3
113 0.25
114 0.24
115 0.21
116 0.2
117 0.19
118 0.17
119 0.12
120 0.11
121 0.13
122 0.12
123 0.21
124 0.23
125 0.25
126 0.33
127 0.37
128 0.41
129 0.43
130 0.43
131 0.37
132 0.41
133 0.47
134 0.44
135 0.44
136 0.41
137 0.42
138 0.43
139 0.39
140 0.31
141 0.24
142 0.2
143 0.18
144 0.18
145 0.15
146 0.17
147 0.19
148 0.19
149 0.23
150 0.25
151 0.24
152 0.22
153 0.22
154 0.19
155 0.18
156 0.19
157 0.16
158 0.15
159 0.13
160 0.13
161 0.11
162 0.1
163 0.09
164 0.07
165 0.06
166 0.07
167 0.09
168 0.11
169 0.11
170 0.12
171 0.12
172 0.13
173 0.14
174 0.13
175 0.15
176 0.14
177 0.15
178 0.24
179 0.24
180 0.25
181 0.27
182 0.26
183 0.26
184 0.31
185 0.33
186 0.33
187 0.42
188 0.5
189 0.59
190 0.7
191 0.75
192 0.8
193 0.86
194 0.86
195 0.87
196 0.89
197 0.88
198 0.88
199 0.88
200 0.83
201 0.78
202 0.69
203 0.6
204 0.5
205 0.4
206 0.32
207 0.27
208 0.28