Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0V5L3

Protein Details
Accession Q0V5L3   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
214-234QGTPEERKKREQERDVRIRNABasic
NLS Segment(s)
PositionSequence
141-170HKRKDRIRAARKAQNLPPSKPNHYNRRSIK
Subcellular Location(s) nucl 21, cyto_nucl 13.5, cyto 4
Family & Domain DBs
KEGG pno:SNOG_00701  -  
Amino Acid Sequences MDWNMDPNFDFKNMEITADDFNVLNADFGDFDRGNMPIYDTNYCESPQGNPGQGFDPLSTPYRQPNTPYYPMAQVQESQGQASTQPTTQTQTTTSQDFNYVPYTHTTQDFSRIPYTQRSIASLEQDLDLAIESGMPYKETHKRKDRIRAARKAQNLPPSKPNHYNRRSIKSLEKARDDARGAGASSPELNKHQHRIHSAQKAQGFVKGPKEINQGTPEERKKREQERDVRIRNAIAADLNISVRQFAKLPLEERQAARERGRAKGLIPTAQAILRKEHSITGSSSRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.2
3 0.2
4 0.21
5 0.2
6 0.2
7 0.13
8 0.13
9 0.13
10 0.12
11 0.1
12 0.07
13 0.07
14 0.07
15 0.08
16 0.14
17 0.13
18 0.13
19 0.15
20 0.15
21 0.16
22 0.15
23 0.18
24 0.15
25 0.19
26 0.2
27 0.21
28 0.22
29 0.22
30 0.22
31 0.21
32 0.18
33 0.17
34 0.2
35 0.22
36 0.25
37 0.23
38 0.25
39 0.25
40 0.26
41 0.25
42 0.2
43 0.17
44 0.16
45 0.18
46 0.18
47 0.18
48 0.24
49 0.27
50 0.28
51 0.31
52 0.37
53 0.42
54 0.45
55 0.45
56 0.41
57 0.4
58 0.41
59 0.39
60 0.31
61 0.25
62 0.23
63 0.25
64 0.22
65 0.18
66 0.16
67 0.14
68 0.14
69 0.15
70 0.14
71 0.1
72 0.12
73 0.13
74 0.15
75 0.16
76 0.17
77 0.17
78 0.2
79 0.22
80 0.23
81 0.23
82 0.2
83 0.22
84 0.21
85 0.2
86 0.19
87 0.17
88 0.15
89 0.17
90 0.19
91 0.18
92 0.19
93 0.2
94 0.16
95 0.22
96 0.23
97 0.23
98 0.23
99 0.23
100 0.24
101 0.26
102 0.29
103 0.26
104 0.25
105 0.24
106 0.24
107 0.24
108 0.25
109 0.21
110 0.18
111 0.14
112 0.14
113 0.11
114 0.09
115 0.07
116 0.05
117 0.04
118 0.03
119 0.03
120 0.04
121 0.04
122 0.05
123 0.06
124 0.1
125 0.18
126 0.24
127 0.32
128 0.4
129 0.47
130 0.53
131 0.64
132 0.69
133 0.72
134 0.77
135 0.78
136 0.76
137 0.76
138 0.76
139 0.71
140 0.66
141 0.64
142 0.59
143 0.52
144 0.52
145 0.5
146 0.5
147 0.54
148 0.57
149 0.58
150 0.58
151 0.65
152 0.64
153 0.66
154 0.64
155 0.58
156 0.58
157 0.57
158 0.61
159 0.57
160 0.54
161 0.5
162 0.48
163 0.49
164 0.43
165 0.34
166 0.28
167 0.23
168 0.19
169 0.17
170 0.16
171 0.11
172 0.11
173 0.11
174 0.1
175 0.12
176 0.16
177 0.19
178 0.26
179 0.29
180 0.33
181 0.37
182 0.42
183 0.48
184 0.53
185 0.53
186 0.52
187 0.5
188 0.49
189 0.44
190 0.43
191 0.38
192 0.32
193 0.34
194 0.33
195 0.32
196 0.33
197 0.39
198 0.36
199 0.36
200 0.36
201 0.34
202 0.33
203 0.42
204 0.45
205 0.47
206 0.5
207 0.54
208 0.59
209 0.66
210 0.72
211 0.73
212 0.75
213 0.77
214 0.84
215 0.83
216 0.79
217 0.7
218 0.61
219 0.52
220 0.43
221 0.33
222 0.23
223 0.16
224 0.13
225 0.12
226 0.12
227 0.11
228 0.11
229 0.11
230 0.11
231 0.11
232 0.11
233 0.13
234 0.19
235 0.22
236 0.25
237 0.3
238 0.35
239 0.39
240 0.39
241 0.44
242 0.44
243 0.45
244 0.46
245 0.45
246 0.43
247 0.44
248 0.48
249 0.42
250 0.36
251 0.39
252 0.4
253 0.39
254 0.37
255 0.34
256 0.31
257 0.32
258 0.35
259 0.28
260 0.29
261 0.28
262 0.29
263 0.28
264 0.3
265 0.29
266 0.28
267 0.3