Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D8QJH9

Protein Details
Accession D8QJH9    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
77-98RIPCLPRPYRLRPRRIPPQSLTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto 5, extr 4, mito 2
Family & Domain DBs
KEGG scm:SCHCO_02591409  -  
Amino Acid Sequences MFSLLPAARSADAAALAGEQRRDARLRLACFEYVRLSLRQDVHKRLGLYLTLVTLSIDGWLRLLSKTPASPTLRLRRIPCLPRPYRLRPRRIPPQSLTPPACACARPGCTADERVPRAYD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.07
3 0.08
4 0.09
5 0.09
6 0.1
7 0.11
8 0.14
9 0.16
10 0.16
11 0.23
12 0.28
13 0.31
14 0.34
15 0.36
16 0.35
17 0.34
18 0.34
19 0.28
20 0.24
21 0.24
22 0.2
23 0.19
24 0.21
25 0.24
26 0.31
27 0.34
28 0.37
29 0.39
30 0.41
31 0.4
32 0.36
33 0.34
34 0.25
35 0.21
36 0.16
37 0.12
38 0.08
39 0.08
40 0.07
41 0.06
42 0.05
43 0.05
44 0.05
45 0.04
46 0.04
47 0.05
48 0.05
49 0.05
50 0.07
51 0.07
52 0.08
53 0.09
54 0.11
55 0.17
56 0.19
57 0.23
58 0.29
59 0.38
60 0.42
61 0.46
62 0.47
63 0.47
64 0.52
65 0.56
66 0.56
67 0.57
68 0.55
69 0.59
70 0.65
71 0.67
72 0.71
73 0.73
74 0.75
75 0.73
76 0.79
77 0.82
78 0.83
79 0.8
80 0.74
81 0.75
82 0.74
83 0.73
84 0.67
85 0.6
86 0.52
87 0.47
88 0.45
89 0.34
90 0.29
91 0.27
92 0.28
93 0.27
94 0.28
95 0.29
96 0.31
97 0.36
98 0.4
99 0.42
100 0.43