Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

D8QLM7

Protein Details
Accession D8QLM7    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-20RKKRAKKEKDPNAPKRPATSBasic
NLS Segment(s)
PositionSequence
1-16RKKRAKKEKDPNAPKR
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
KEGG scm:SCHCO_02450672  -  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
Amino Acid Sequences RKKRAKKEKDPNAPKRPATSYILYQNDCRQSMKEKNPGLHNTELLRYISETWKSLPEQEKSSYEAKAAKLKHDYEDAVREY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.77
3 0.7
4 0.64
5 0.57
6 0.51
7 0.45
8 0.46
9 0.48
10 0.43
11 0.41
12 0.41
13 0.41
14 0.38
15 0.34
16 0.27
17 0.3
18 0.37
19 0.43
20 0.46
21 0.44
22 0.47
23 0.52
24 0.53
25 0.5
26 0.43
27 0.37
28 0.29
29 0.27
30 0.25
31 0.18
32 0.16
33 0.12
34 0.12
35 0.14
36 0.14
37 0.14
38 0.14
39 0.17
40 0.17
41 0.23
42 0.27
43 0.27
44 0.29
45 0.32
46 0.33
47 0.33
48 0.35
49 0.29
50 0.26
51 0.27
52 0.26
53 0.29
54 0.29
55 0.32
56 0.36
57 0.38
58 0.39
59 0.39
60 0.39
61 0.37