Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D8PY36

Protein Details
Accession D8PY36    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
33-57AADLSRQPHKRKRVRKATSKAARKTHydrophilic
NLS Segment(s)
PositionSequence
40-56PHKRKRVRKATSKAARK
91-99PKRKKGAAG
Subcellular Location(s) nucl 11mito 11mito_nucl 11
Family & Domain DBs
KEGG scm:SCHCO_02725797  -  
Amino Acid Sequences MRQGEPLPPSMWAMVYLTCAQGQLIAGSFEIPAADLSRQPHKRKRVRKATSKAARKTNIQAHSTQSQRGNAEETTGASTDTGPERLTAPQPKRKKGAAGTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.14
3 0.13
4 0.13
5 0.12
6 0.12
7 0.1
8 0.1
9 0.1
10 0.07
11 0.07
12 0.07
13 0.06
14 0.07
15 0.07
16 0.06
17 0.05
18 0.05
19 0.05
20 0.06
21 0.06
22 0.08
23 0.11
24 0.2
25 0.28
26 0.34
27 0.42
28 0.51
29 0.6
30 0.68
31 0.77
32 0.79
33 0.81
34 0.84
35 0.84
36 0.85
37 0.85
38 0.84
39 0.79
40 0.75
41 0.69
42 0.61
43 0.6
44 0.57
45 0.53
46 0.46
47 0.42
48 0.38
49 0.41
50 0.4
51 0.38
52 0.32
53 0.3
54 0.29
55 0.28
56 0.27
57 0.21
58 0.21
59 0.17
60 0.16
61 0.14
62 0.14
63 0.13
64 0.1
65 0.1
66 0.11
67 0.12
68 0.12
69 0.1
70 0.11
71 0.12
72 0.15
73 0.22
74 0.3
75 0.36
76 0.45
77 0.54
78 0.61
79 0.66
80 0.68
81 0.69