Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D8PR56

Protein Details
Accession D8PR56   
Localization Confidence High
Confidence Score 17.4
NoLS Segment(s)
PositionSequenceProtein Nature
34-61GTAAPSSYSRNKKLKKHKPGRGSEFYTTHydrophilic
230-256RDRDRERERDRERGRRRHKSASAPVIVBasic
NLS Segment(s)
PositionSequence
44-54NKKLKKHKPGR
232-249RDRERERDRERGRRRHKS
Subcellular Location(s) nucl 20, cyto_nucl 12, mito 5
Family & Domain DBs
KEGG scm:SCHCO_01166032  -  
Amino Acid Sequences MPKFNIFKAFSKKNKGVKDVPNHAASSSDTRSMGTAAPSSYSRNKKLKKHKPGRGSEFYTTPLSPIQSVGTVPTNGGSRYGGVSLKDEGFLPPPGGAHSLRTSNGLQRGPPTQAARSRRHGTSEAGGSFMPRRGRHDSPISEKEYEPTIFDAPLTHQQSMRTTGTRRSDDSPDRHEGTHYTGTHRSAAPTRYTGAQHVPTHQTGTHHTGSHAGHRRAASQQVPTVTRTHRDRDRERERDRERGRRRHKSASAPVIVPPSPMRAARTIHEGVNQRPEIVKIPHAGEPSDFYIVPDGVDVEFRDAMGNVLGKMRVGESLRGSVTSAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.77
3 0.76
4 0.76
5 0.78
6 0.77
7 0.74
8 0.69
9 0.62
10 0.54
11 0.47
12 0.4
13 0.36
14 0.3
15 0.27
16 0.23
17 0.23
18 0.24
19 0.23
20 0.22
21 0.18
22 0.17
23 0.14
24 0.16
25 0.17
26 0.22
27 0.29
28 0.35
29 0.42
30 0.5
31 0.58
32 0.65
33 0.76
34 0.82
35 0.84
36 0.87
37 0.88
38 0.89
39 0.91
40 0.9
41 0.88
42 0.84
43 0.76
44 0.67
45 0.61
46 0.54
47 0.43
48 0.35
49 0.28
50 0.22
51 0.19
52 0.17
53 0.15
54 0.12
55 0.12
56 0.13
57 0.14
58 0.13
59 0.13
60 0.14
61 0.14
62 0.13
63 0.14
64 0.12
65 0.1
66 0.11
67 0.13
68 0.13
69 0.12
70 0.14
71 0.15
72 0.15
73 0.15
74 0.14
75 0.13
76 0.14
77 0.14
78 0.13
79 0.11
80 0.1
81 0.11
82 0.13
83 0.13
84 0.13
85 0.15
86 0.16
87 0.17
88 0.2
89 0.2
90 0.21
91 0.27
92 0.25
93 0.24
94 0.24
95 0.26
96 0.26
97 0.29
98 0.27
99 0.26
100 0.32
101 0.38
102 0.41
103 0.46
104 0.49
105 0.45
106 0.47
107 0.45
108 0.4
109 0.37
110 0.35
111 0.28
112 0.24
113 0.22
114 0.19
115 0.18
116 0.19
117 0.2
118 0.17
119 0.22
120 0.28
121 0.31
122 0.35
123 0.41
124 0.42
125 0.45
126 0.5
127 0.49
128 0.44
129 0.41
130 0.37
131 0.33
132 0.28
133 0.21
134 0.17
135 0.14
136 0.12
137 0.12
138 0.11
139 0.1
140 0.18
141 0.19
142 0.18
143 0.18
144 0.2
145 0.21
146 0.25
147 0.25
148 0.2
149 0.19
150 0.24
151 0.29
152 0.3
153 0.31
154 0.3
155 0.34
156 0.38
157 0.41
158 0.41
159 0.4
160 0.39
161 0.37
162 0.34
163 0.29
164 0.28
165 0.3
166 0.25
167 0.24
168 0.24
169 0.25
170 0.27
171 0.26
172 0.23
173 0.21
174 0.23
175 0.21
176 0.2
177 0.2
178 0.2
179 0.21
180 0.21
181 0.21
182 0.24
183 0.23
184 0.25
185 0.28
186 0.26
187 0.27
188 0.26
189 0.23
190 0.21
191 0.26
192 0.25
193 0.22
194 0.22
195 0.25
196 0.24
197 0.32
198 0.37
199 0.32
200 0.33
201 0.33
202 0.35
203 0.33
204 0.37
205 0.31
206 0.25
207 0.27
208 0.27
209 0.28
210 0.28
211 0.3
212 0.26
213 0.31
214 0.32
215 0.36
216 0.39
217 0.47
218 0.53
219 0.6
220 0.69
221 0.72
222 0.74
223 0.77
224 0.75
225 0.77
226 0.78
227 0.78
228 0.78
229 0.79
230 0.83
231 0.84
232 0.86
233 0.85
234 0.84
235 0.83
236 0.83
237 0.81
238 0.74
239 0.64
240 0.6
241 0.54
242 0.46
243 0.38
244 0.29
245 0.23
246 0.22
247 0.22
248 0.22
249 0.22
250 0.24
251 0.25
252 0.31
253 0.29
254 0.28
255 0.33
256 0.35
257 0.34
258 0.41
259 0.39
260 0.33
261 0.32
262 0.32
263 0.32
264 0.3
265 0.3
266 0.25
267 0.28
268 0.31
269 0.31
270 0.3
271 0.25
272 0.26
273 0.26
274 0.25
275 0.22
276 0.18
277 0.2
278 0.19
279 0.18
280 0.14
281 0.12
282 0.1
283 0.11
284 0.11
285 0.12
286 0.12
287 0.12
288 0.12
289 0.11
290 0.12
291 0.13
292 0.13
293 0.11
294 0.13
295 0.13
296 0.13
297 0.13
298 0.13
299 0.16
300 0.17
301 0.21
302 0.21
303 0.26
304 0.27
305 0.26