Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D8PQI1

Protein Details
Accession D8PQI1    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
29-57FDYKRRNDAGFRRRLRKDKKRADKTLAESBasic
NLS Segment(s)
PositionSequence
35-50NDAGFRRRLRKDKKRA
Subcellular Location(s) mito 8, cyto 7, extr 5, nucl 4, E.R. 1, golg 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR002056  MAS20  
IPR023392  Tom20_dom_sf  
Gene Ontology GO:0005742  C:mitochondrial outer membrane translocase complex  
GO:0006605  P:protein targeting  
Pfam View protein in Pfam  
PF02064  MAS20  
Amino Acid Sequences MSSSSRSTSVATIAGITVLGGLIAYAAYFDYKRRNDAGFRRRLRKDKKRADKTLAESLPPPITKEVILEALERAKLEPAPASPELREPYFMDQISKGEKLSLLGPELHLEAALCFYKGLQVYPSPMELIVIYQKTVPEPIFKLVTQMMDLDVSANSLGMGMAMGMGVGLGLGPDAGIDIADLEAAAAAAPTSSGPPSETSSQDWDKVTDPASN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.09
3 0.08
4 0.06
5 0.04
6 0.04
7 0.03
8 0.03
9 0.02
10 0.02
11 0.02
12 0.02
13 0.03
14 0.05
15 0.05
16 0.08
17 0.17
18 0.2
19 0.24
20 0.27
21 0.3
22 0.37
23 0.48
24 0.55
25 0.57
26 0.63
27 0.69
28 0.74
29 0.81
30 0.84
31 0.84
32 0.85
33 0.86
34 0.89
35 0.9
36 0.9
37 0.88
38 0.85
39 0.8
40 0.79
41 0.69
42 0.59
43 0.49
44 0.44
45 0.4
46 0.32
47 0.27
48 0.18
49 0.18
50 0.17
51 0.16
52 0.15
53 0.13
54 0.13
55 0.12
56 0.12
57 0.12
58 0.13
59 0.12
60 0.11
61 0.09
62 0.09
63 0.09
64 0.09
65 0.09
66 0.13
67 0.15
68 0.16
69 0.15
70 0.19
71 0.2
72 0.19
73 0.2
74 0.17
75 0.19
76 0.21
77 0.21
78 0.18
79 0.17
80 0.18
81 0.19
82 0.18
83 0.14
84 0.11
85 0.11
86 0.1
87 0.11
88 0.1
89 0.08
90 0.08
91 0.08
92 0.09
93 0.09
94 0.08
95 0.06
96 0.05
97 0.04
98 0.06
99 0.05
100 0.05
101 0.04
102 0.04
103 0.07
104 0.07
105 0.08
106 0.08
107 0.08
108 0.1
109 0.11
110 0.12
111 0.1
112 0.09
113 0.09
114 0.08
115 0.08
116 0.09
117 0.09
118 0.09
119 0.09
120 0.09
121 0.1
122 0.12
123 0.12
124 0.11
125 0.13
126 0.15
127 0.17
128 0.17
129 0.19
130 0.18
131 0.18
132 0.15
133 0.14
134 0.11
135 0.09
136 0.09
137 0.08
138 0.06
139 0.06
140 0.05
141 0.05
142 0.04
143 0.04
144 0.04
145 0.03
146 0.03
147 0.02
148 0.02
149 0.02
150 0.02
151 0.02
152 0.02
153 0.02
154 0.02
155 0.01
156 0.01
157 0.02
158 0.02
159 0.02
160 0.02
161 0.02
162 0.02
163 0.02
164 0.02
165 0.03
166 0.03
167 0.03
168 0.03
169 0.03
170 0.03
171 0.03
172 0.03
173 0.02
174 0.02
175 0.02
176 0.03
177 0.03
178 0.05
179 0.06
180 0.06
181 0.08
182 0.11
183 0.16
184 0.19
185 0.22
186 0.24
187 0.31
188 0.34
189 0.36
190 0.35
191 0.33
192 0.31
193 0.31