Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D8PKX5

Protein Details
Accession D8PKX5    Localization Confidence Medium Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
664-697GLYGRQAGKEERRRRRREKRARRKEREMHKVYSIBasic
NLS Segment(s)
PositionSequence
232-254RRRRREEREASHRVREKSRVRER
671-689GKEERRRRRREKRARRKER
Subcellular Location(s) nucl 15.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR028018  DUF4646  
Pfam View protein in Pfam  
PF15496  DUF4646  
Amino Acid Sequences MSSIYRAASPYGRSASPNPYGAHPPASPYAQPASIPYGGQQAGSVYGQPAAASGYAAAPYGQGPTTPYAQPATSPFAPTAPSPYGQPAASPYATSTPAYGARAASPYAQPSMLPHTPGPTTPYGDPGMGGMGAPQPQTQGQASIQPGSITYTTSTGPDGRLVYHPFKAVPASYKTSTGIVSGIQWVPAEATSVLPSGAQPANDDFMSSWTRTGRLNAEEERSVKEWQRDEDRRRRREEREASHRVREKSRVRERSSVRGDDFELERARDRDNAARSRRKSFVGPAASPYAATQTYGAQGMPGGTSPYAPPASPYVGSNAGGYAGSTAGTAGGYAGSAAGGYAGSAAGGYTRERKYSTGEQLASHMADLDLDRGVDYNTRQSRRRSAYGAPDAGGYSTRPTTPGYTGQVYPKGHIMEGQPIPPGQPYPTARSRATTPAPPSHTPLPGTTSSAYGGPVTFPSAGVGGGASPNMGGNLALAGGPPILPETGQLAPPESFSRPPNAAMPYTPFASPMYIAQMTDIVRDIPPMPLVLGPHDVSHEDWTRMMADIARAWAGVLPIAQDGRKQKRSSLVSHMLDAWNQNFYMARGVEVVLYKGRERRSGPASGMMDGVLQDGRFSDTEESDTTESDLDDENSLTGAYGGAYGGGGAYGRGADGNYGRNADGLYGRQAGKEERRRRRREKRARRKEREMHKVYSIQIICLPSGGPGGAGAVAQAPPMTPAGMASPYHRGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.4
3 0.41
4 0.44
5 0.39
6 0.39
7 0.44
8 0.43
9 0.43
10 0.36
11 0.35
12 0.34
13 0.36
14 0.32
15 0.3
16 0.31
17 0.28
18 0.27
19 0.26
20 0.27
21 0.25
22 0.25
23 0.22
24 0.24
25 0.23
26 0.23
27 0.2
28 0.15
29 0.16
30 0.17
31 0.16
32 0.11
33 0.12
34 0.11
35 0.11
36 0.1
37 0.09
38 0.08
39 0.08
40 0.08
41 0.07
42 0.08
43 0.08
44 0.08
45 0.07
46 0.07
47 0.09
48 0.09
49 0.08
50 0.11
51 0.13
52 0.17
53 0.18
54 0.19
55 0.2
56 0.2
57 0.22
58 0.23
59 0.27
60 0.25
61 0.26
62 0.25
63 0.23
64 0.25
65 0.23
66 0.26
67 0.21
68 0.2
69 0.2
70 0.24
71 0.26
72 0.24
73 0.24
74 0.22
75 0.24
76 0.23
77 0.22
78 0.2
79 0.2
80 0.22
81 0.22
82 0.19
83 0.16
84 0.19
85 0.2
86 0.2
87 0.17
88 0.17
89 0.19
90 0.19
91 0.18
92 0.18
93 0.19
94 0.19
95 0.18
96 0.16
97 0.17
98 0.24
99 0.24
100 0.24
101 0.23
102 0.24
103 0.25
104 0.26
105 0.28
106 0.23
107 0.25
108 0.23
109 0.26
110 0.25
111 0.23
112 0.22
113 0.18
114 0.16
115 0.11
116 0.11
117 0.08
118 0.08
119 0.1
120 0.1
121 0.1
122 0.11
123 0.12
124 0.15
125 0.14
126 0.15
127 0.15
128 0.2
129 0.21
130 0.21
131 0.21
132 0.18
133 0.18
134 0.18
135 0.18
136 0.13
137 0.12
138 0.12
139 0.12
140 0.13
141 0.14
142 0.13
143 0.13
144 0.15
145 0.15
146 0.15
147 0.19
148 0.24
149 0.26
150 0.26
151 0.27
152 0.24
153 0.25
154 0.25
155 0.22
156 0.22
157 0.23
158 0.27
159 0.27
160 0.28
161 0.28
162 0.28
163 0.26
164 0.22
165 0.17
166 0.12
167 0.11
168 0.13
169 0.12
170 0.12
171 0.11
172 0.1
173 0.1
174 0.1
175 0.11
176 0.07
177 0.08
178 0.08
179 0.08
180 0.08
181 0.08
182 0.08
183 0.1
184 0.11
185 0.11
186 0.11
187 0.12
188 0.15
189 0.14
190 0.15
191 0.11
192 0.13
193 0.15
194 0.14
195 0.15
196 0.14
197 0.15
198 0.16
199 0.18
200 0.19
201 0.2
202 0.24
203 0.25
204 0.28
205 0.3
206 0.3
207 0.31
208 0.29
209 0.29
210 0.28
211 0.31
212 0.3
213 0.32
214 0.41
215 0.46
216 0.54
217 0.62
218 0.68
219 0.71
220 0.76
221 0.79
222 0.76
223 0.77
224 0.78
225 0.77
226 0.77
227 0.79
228 0.75
229 0.76
230 0.75
231 0.69
232 0.63
233 0.63
234 0.61
235 0.61
236 0.68
237 0.68
238 0.67
239 0.72
240 0.72
241 0.73
242 0.71
243 0.65
244 0.56
245 0.48
246 0.44
247 0.38
248 0.35
249 0.29
250 0.24
251 0.19
252 0.21
253 0.2
254 0.2
255 0.19
256 0.21
257 0.23
258 0.28
259 0.36
260 0.42
261 0.5
262 0.52
263 0.55
264 0.56
265 0.52
266 0.47
267 0.44
268 0.44
269 0.41
270 0.38
271 0.36
272 0.35
273 0.33
274 0.3
275 0.25
276 0.19
277 0.13
278 0.12
279 0.1
280 0.08
281 0.09
282 0.09
283 0.09
284 0.06
285 0.06
286 0.06
287 0.06
288 0.05
289 0.05
290 0.05
291 0.05
292 0.05
293 0.08
294 0.09
295 0.08
296 0.09
297 0.11
298 0.13
299 0.13
300 0.13
301 0.13
302 0.13
303 0.14
304 0.13
305 0.11
306 0.09
307 0.09
308 0.08
309 0.06
310 0.04
311 0.04
312 0.04
313 0.04
314 0.03
315 0.03
316 0.03
317 0.03
318 0.03
319 0.02
320 0.02
321 0.02
322 0.02
323 0.02
324 0.02
325 0.02
326 0.02
327 0.02
328 0.02
329 0.02
330 0.02
331 0.02
332 0.02
333 0.02
334 0.03
335 0.04
336 0.1
337 0.11
338 0.13
339 0.14
340 0.15
341 0.2
342 0.26
343 0.31
344 0.31
345 0.31
346 0.3
347 0.3
348 0.3
349 0.25
350 0.18
351 0.13
352 0.07
353 0.06
354 0.06
355 0.05
356 0.04
357 0.04
358 0.04
359 0.04
360 0.05
361 0.06
362 0.06
363 0.13
364 0.19
365 0.23
366 0.27
367 0.3
368 0.39
369 0.43
370 0.46
371 0.42
372 0.41
373 0.46
374 0.47
375 0.45
376 0.36
377 0.31
378 0.28
379 0.24
380 0.2
381 0.11
382 0.08
383 0.08
384 0.07
385 0.08
386 0.09
387 0.11
388 0.13
389 0.16
390 0.18
391 0.19
392 0.21
393 0.22
394 0.27
395 0.26
396 0.24
397 0.24
398 0.21
399 0.18
400 0.19
401 0.18
402 0.19
403 0.19
404 0.2
405 0.17
406 0.17
407 0.17
408 0.15
409 0.15
410 0.09
411 0.14
412 0.16
413 0.21
414 0.26
415 0.3
416 0.3
417 0.32
418 0.34
419 0.33
420 0.34
421 0.33
422 0.33
423 0.35
424 0.4
425 0.39
426 0.4
427 0.38
428 0.37
429 0.33
430 0.29
431 0.27
432 0.22
433 0.24
434 0.2
435 0.17
436 0.16
437 0.15
438 0.14
439 0.1
440 0.09
441 0.07
442 0.07
443 0.08
444 0.07
445 0.07
446 0.07
447 0.07
448 0.07
449 0.06
450 0.06
451 0.04
452 0.04
453 0.04
454 0.03
455 0.03
456 0.03
457 0.03
458 0.03
459 0.03
460 0.03
461 0.03
462 0.03
463 0.03
464 0.03
465 0.03
466 0.03
467 0.03
468 0.03
469 0.04
470 0.04
471 0.04
472 0.04
473 0.08
474 0.09
475 0.1
476 0.11
477 0.12
478 0.12
479 0.14
480 0.16
481 0.14
482 0.16
483 0.16
484 0.21
485 0.2
486 0.21
487 0.24
488 0.24
489 0.23
490 0.22
491 0.25
492 0.23
493 0.23
494 0.22
495 0.18
496 0.16
497 0.16
498 0.15
499 0.11
500 0.14
501 0.12
502 0.12
503 0.12
504 0.14
505 0.13
506 0.13
507 0.13
508 0.09
509 0.09
510 0.11
511 0.11
512 0.09
513 0.09
514 0.09
515 0.09
516 0.09
517 0.1
518 0.11
519 0.13
520 0.13
521 0.12
522 0.13
523 0.14
524 0.14
525 0.18
526 0.19
527 0.16
528 0.16
529 0.17
530 0.17
531 0.16
532 0.15
533 0.11
534 0.1
535 0.1
536 0.11
537 0.11
538 0.1
539 0.09
540 0.1
541 0.09
542 0.07
543 0.07
544 0.06
545 0.07
546 0.09
547 0.09
548 0.12
549 0.21
550 0.3
551 0.38
552 0.38
553 0.41
554 0.49
555 0.54
556 0.55
557 0.55
558 0.56
559 0.5
560 0.5
561 0.49
562 0.41
563 0.37
564 0.34
565 0.26
566 0.18
567 0.16
568 0.15
569 0.13
570 0.13
571 0.16
572 0.13
573 0.13
574 0.12
575 0.13
576 0.14
577 0.14
578 0.15
579 0.13
580 0.14
581 0.17
582 0.21
583 0.24
584 0.28
585 0.3
586 0.36
587 0.38
588 0.41
589 0.4
590 0.44
591 0.42
592 0.37
593 0.34
594 0.27
595 0.23
596 0.18
597 0.17
598 0.09
599 0.08
600 0.07
601 0.07
602 0.09
603 0.09
604 0.11
605 0.13
606 0.13
607 0.16
608 0.16
609 0.19
610 0.18
611 0.18
612 0.17
613 0.15
614 0.14
615 0.13
616 0.13
617 0.11
618 0.11
619 0.11
620 0.1
621 0.1
622 0.1
623 0.08
624 0.07
625 0.06
626 0.05
627 0.05
628 0.04
629 0.04
630 0.04
631 0.04
632 0.04
633 0.04
634 0.03
635 0.03
636 0.03
637 0.03
638 0.04
639 0.04
640 0.04
641 0.07
642 0.1
643 0.14
644 0.16
645 0.18
646 0.18
647 0.18
648 0.18
649 0.17
650 0.18
651 0.15
652 0.17
653 0.21
654 0.21
655 0.22
656 0.24
657 0.29
658 0.37
659 0.46
660 0.53
661 0.59
662 0.7
663 0.79
664 0.88
665 0.92
666 0.93
667 0.94
668 0.95
669 0.96
670 0.96
671 0.97
672 0.96
673 0.96
674 0.95
675 0.94
676 0.94
677 0.89
678 0.83
679 0.79
680 0.73
681 0.64
682 0.64
683 0.53
684 0.44
685 0.41
686 0.36
687 0.29
688 0.25
689 0.23
690 0.14
691 0.14
692 0.13
693 0.09
694 0.07
695 0.08
696 0.07
697 0.07
698 0.06
699 0.07
700 0.07
701 0.07
702 0.07
703 0.07
704 0.08
705 0.09
706 0.09
707 0.07
708 0.08
709 0.1
710 0.14
711 0.15
712 0.16