Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D8QJV1

Protein Details
Accession D8QJV1   
Localization Confidence Low
Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
126-149ITVKLKIRRGWRVTARPRTLRFRLHydrophilic
NLS Segment(s)
Subcellular Location(s) cysk 17, nucl 6, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR022775  AP_mu_sigma_su  
IPR001392  Clathrin_mu  
IPR011012  Longin-like_dom_sf  
Gene Ontology GO:0030131  C:clathrin adaptor complex  
GO:0006886  P:intracellular protein transport  
GO:0016192  P:vesicle-mediated transport  
KEGG scm:SCHCO_02681675  -  
Pfam View protein in Pfam  
PF01217  Clat_adaptor_s  
Amino Acid Sequences MASLIAILDLKGKPLIQRSYRDDVPASYVERFLPLVLDLEEEGQQVTPCISAQGINYMHIRHSNLYLLALSKRNSNAAEIILFLHRLSQVLVEYFKELEEESIRDNFVIIYELLDEVMDFGYRAPITVKLKIRRGWRVTARPRTLRFRLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.32
3 0.34
4 0.41
5 0.47
6 0.53
7 0.54
8 0.54
9 0.47
10 0.4
11 0.38
12 0.34
13 0.29
14 0.23
15 0.22
16 0.19
17 0.19
18 0.18
19 0.14
20 0.11
21 0.09
22 0.09
23 0.09
24 0.09
25 0.08
26 0.09
27 0.09
28 0.09
29 0.08
30 0.07
31 0.07
32 0.06
33 0.06
34 0.05
35 0.05
36 0.05
37 0.05
38 0.06
39 0.06
40 0.12
41 0.12
42 0.14
43 0.15
44 0.15
45 0.16
46 0.17
47 0.18
48 0.13
49 0.13
50 0.13
51 0.12
52 0.12
53 0.11
54 0.1
55 0.11
56 0.13
57 0.12
58 0.13
59 0.14
60 0.15
61 0.15
62 0.15
63 0.13
64 0.11
65 0.11
66 0.09
67 0.09
68 0.08
69 0.08
70 0.07
71 0.07
72 0.06
73 0.06
74 0.06
75 0.06
76 0.06
77 0.07
78 0.08
79 0.08
80 0.09
81 0.08
82 0.08
83 0.08
84 0.07
85 0.08
86 0.09
87 0.09
88 0.1
89 0.11
90 0.12
91 0.11
92 0.11
93 0.09
94 0.08
95 0.09
96 0.07
97 0.06
98 0.06
99 0.06
100 0.06
101 0.06
102 0.06
103 0.05
104 0.05
105 0.05
106 0.04
107 0.04
108 0.08
109 0.08
110 0.08
111 0.09
112 0.16
113 0.2
114 0.27
115 0.36
116 0.4
117 0.48
118 0.53
119 0.6
120 0.64
121 0.65
122 0.67
123 0.69
124 0.72
125 0.76
126 0.81
127 0.82
128 0.81
129 0.83
130 0.82