Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D8QBY2

Protein Details
Accession D8QBY2    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
13-45KVKSQTPKVEKQEKKKVPKGRAKKRILYNRRFVBasic
NLS Segment(s)
PositionSequence
12-38GKVKSQTPKVEKQEKKKVPKGRAKKRI
Subcellular Location(s) nucl 14.5, mito 10, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG scm:SCHCO_02634287  -  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQTPKVEKQEKKKVPKGRAKKRILYNRRFVNVTTLPGGKRRMNPNPEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.46
4 0.49
5 0.53
6 0.62
7 0.65
8 0.71
9 0.72
10 0.74
11 0.77
12 0.77
13 0.8
14 0.79
15 0.79
16 0.78
17 0.81
18 0.82
19 0.82
20 0.84
21 0.81
22 0.81
23 0.82
24 0.83
25 0.83
26 0.8
27 0.78
28 0.75
29 0.72
30 0.65
31 0.56
32 0.53
33 0.45
34 0.4
35 0.34
36 0.3
37 0.28
38 0.31
39 0.36
40 0.34
41 0.39
42 0.45
43 0.52