Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D8PKM1

Protein Details
Accession D8PKM1    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
28-48AAAPPAKKRARKTKEKDAEDGBasic
NLS Segment(s)
PositionSequence
32-45PAKKRARKTKEKDA
174-181PGPSRRRR
Subcellular Location(s) nucl 19, cyto_nucl 13.5, cyto 6
Family & Domain DBs
KEGG scm:SCHCO_0231789  -  
Amino Acid Sequences MPPRAAKRKSDVVDSDSDYDGIEVVEEAAAPPAKKRARKTKEKDAEDGGDKPKRWQDVKLEGEDEDMVPVYDDCAEVRRKIRLLEKTPGFVRAQWLREIGNVNSNSFGRFMASKERDAGGGNSTYPKAYIYFEKMRILEGKKKTASRLRNEETHPNGFPLENRRTHMWVFTGKPGPSRRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.47
3 0.38
4 0.35
5 0.26
6 0.22
7 0.18
8 0.12
9 0.08
10 0.05
11 0.05
12 0.04
13 0.04
14 0.04
15 0.07
16 0.09
17 0.09
18 0.1
19 0.18
20 0.25
21 0.31
22 0.4
23 0.49
24 0.57
25 0.68
26 0.76
27 0.79
28 0.83
29 0.82
30 0.77
31 0.71
32 0.66
33 0.58
34 0.54
35 0.49
36 0.44
37 0.4
38 0.39
39 0.38
40 0.4
41 0.38
42 0.39
43 0.4
44 0.45
45 0.49
46 0.48
47 0.44
48 0.38
49 0.37
50 0.33
51 0.24
52 0.14
53 0.1
54 0.07
55 0.06
56 0.05
57 0.05
58 0.04
59 0.05
60 0.04
61 0.08
62 0.09
63 0.11
64 0.14
65 0.16
66 0.17
67 0.2
68 0.27
69 0.32
70 0.36
71 0.42
72 0.41
73 0.41
74 0.41
75 0.41
76 0.34
77 0.26
78 0.26
79 0.22
80 0.22
81 0.2
82 0.21
83 0.18
84 0.19
85 0.22
86 0.17
87 0.19
88 0.18
89 0.17
90 0.18
91 0.18
92 0.17
93 0.15
94 0.14
95 0.08
96 0.08
97 0.09
98 0.18
99 0.2
100 0.21
101 0.22
102 0.22
103 0.22
104 0.22
105 0.22
106 0.15
107 0.13
108 0.12
109 0.13
110 0.13
111 0.12
112 0.11
113 0.11
114 0.1
115 0.11
116 0.14
117 0.19
118 0.25
119 0.27
120 0.31
121 0.31
122 0.31
123 0.35
124 0.37
125 0.38
126 0.38
127 0.43
128 0.45
129 0.47
130 0.53
131 0.56
132 0.6
133 0.61
134 0.65
135 0.63
136 0.65
137 0.67
138 0.69
139 0.67
140 0.63
141 0.55
142 0.46
143 0.42
144 0.36
145 0.35
146 0.34
147 0.35
148 0.34
149 0.37
150 0.39
151 0.42
152 0.43
153 0.42
154 0.38
155 0.37
156 0.37
157 0.41
158 0.44
159 0.41
160 0.47
161 0.53