Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D8PTR2

Protein Details
Accession D8PTR2    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
208-236YEGNDRSKSLERRRRGKRTQTQVPPLPLSHydrophilic
NLS Segment(s)
PositionSequence
71-78PRRRNKLA
219-224RRRRGK
Subcellular Location(s) nucl 17, cyto_nucl 13.5, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR036882  Alba-like_dom_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
KEGG scm:SCHCO_01120045  -  
Amino Acid Sequences MAANKRKADTTIDKPGPAKRAKAIDEATADTANQTSAPEAPAPIHQPDHQDPPDMEAGAASEKVPGTVKTPRRRNKLAPPRPWPTVARADSATGPRSAHKEGKNYICITRKTSLGAYLRRCKDLVLKDGYKTLHLSAMGAAIPHLVQLSVALPPILPYDPSEIHSEITTGTIHVHDEIVPDNEDEDITYEKRGKSTLMIVMKIGDGEYEGNDRSKSLERRRRGKRTQTQVPPLPLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.57
3 0.57
4 0.53
5 0.49
6 0.45
7 0.49
8 0.49
9 0.53
10 0.5
11 0.46
12 0.44
13 0.43
14 0.38
15 0.31
16 0.27
17 0.2
18 0.18
19 0.14
20 0.11
21 0.09
22 0.07
23 0.08
24 0.1
25 0.1
26 0.1
27 0.11
28 0.14
29 0.17
30 0.19
31 0.2
32 0.21
33 0.27
34 0.3
35 0.37
36 0.35
37 0.36
38 0.33
39 0.34
40 0.35
41 0.28
42 0.24
43 0.15
44 0.15
45 0.12
46 0.13
47 0.08
48 0.07
49 0.07
50 0.08
51 0.09
52 0.09
53 0.12
54 0.2
55 0.29
56 0.38
57 0.48
58 0.57
59 0.64
60 0.7
61 0.74
62 0.77
63 0.8
64 0.8
65 0.79
66 0.78
67 0.76
68 0.72
69 0.68
70 0.58
71 0.52
72 0.51
73 0.43
74 0.37
75 0.32
76 0.3
77 0.29
78 0.3
79 0.26
80 0.17
81 0.16
82 0.16
83 0.19
84 0.21
85 0.25
86 0.26
87 0.3
88 0.34
89 0.39
90 0.41
91 0.39
92 0.41
93 0.4
94 0.38
95 0.37
96 0.33
97 0.29
98 0.26
99 0.25
100 0.26
101 0.25
102 0.29
103 0.31
104 0.37
105 0.38
106 0.38
107 0.38
108 0.33
109 0.34
110 0.33
111 0.32
112 0.31
113 0.31
114 0.3
115 0.33
116 0.33
117 0.28
118 0.24
119 0.19
120 0.14
121 0.12
122 0.12
123 0.09
124 0.09
125 0.08
126 0.07
127 0.06
128 0.05
129 0.05
130 0.04
131 0.04
132 0.03
133 0.03
134 0.03
135 0.04
136 0.04
137 0.05
138 0.04
139 0.04
140 0.05
141 0.07
142 0.07
143 0.06
144 0.07
145 0.12
146 0.13
147 0.15
148 0.18
149 0.17
150 0.17
151 0.17
152 0.16
153 0.12
154 0.12
155 0.1
156 0.07
157 0.07
158 0.07
159 0.07
160 0.08
161 0.08
162 0.07
163 0.08
164 0.1
165 0.11
166 0.11
167 0.11
168 0.11
169 0.1
170 0.1
171 0.09
172 0.09
173 0.1
174 0.1
175 0.13
176 0.17
177 0.17
178 0.19
179 0.19
180 0.18
181 0.18
182 0.22
183 0.27
184 0.27
185 0.27
186 0.27
187 0.27
188 0.26
189 0.23
190 0.18
191 0.11
192 0.07
193 0.07
194 0.08
195 0.1
196 0.11
197 0.13
198 0.13
199 0.14
200 0.17
201 0.24
202 0.33
203 0.41
204 0.5
205 0.58
206 0.68
207 0.79
208 0.86
209 0.88
210 0.9
211 0.89
212 0.9
213 0.91
214 0.91
215 0.91
216 0.88