Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D8Q8K4

Protein Details
Accession D8Q8K4    Localization Confidence Low Confidence Score 5.4
NoLS Segment(s)
PositionSequenceProtein Nature
38-57AIVVTRRRIRWRNRYFRIFFHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 9, mito 8, extr 4, E.R. 3, nucl 1, cyto 1, cyto_nucl 1, golg 1
Family & Domain DBs
KEGG scm:SCHCO_02690693  -  
Amino Acid Sequences MFLFTPSFSNLTFGAESITVVISVIPNVRIPQGRRFYAIVVTRRRIRWRNRYFRIFFGVDDVTFIKALDDDISVLLISPTIYLSVVLGMLIRCVHEACGNREVIDRKTISTSGHSYETAQAFPGRYLVASPRGLVQQATRLEMRNFTIMNCLSRLVRHRALSSLLTGSGNPSPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.13
4 0.11
5 0.11
6 0.07
7 0.07
8 0.07
9 0.06
10 0.07
11 0.08
12 0.08
13 0.09
14 0.1
15 0.14
16 0.19
17 0.22
18 0.31
19 0.36
20 0.37
21 0.39
22 0.4
23 0.37
24 0.39
25 0.42
26 0.4
27 0.4
28 0.45
29 0.47
30 0.51
31 0.59
32 0.6
33 0.64
34 0.67
35 0.71
36 0.77
37 0.8
38 0.84
39 0.79
40 0.74
41 0.7
42 0.6
43 0.48
44 0.41
45 0.33
46 0.23
47 0.22
48 0.19
49 0.13
50 0.12
51 0.12
52 0.07
53 0.06
54 0.07
55 0.06
56 0.05
57 0.05
58 0.05
59 0.05
60 0.05
61 0.05
62 0.04
63 0.03
64 0.03
65 0.03
66 0.03
67 0.03
68 0.03
69 0.03
70 0.03
71 0.03
72 0.03
73 0.03
74 0.04
75 0.03
76 0.04
77 0.04
78 0.04
79 0.04
80 0.04
81 0.05
82 0.08
83 0.11
84 0.14
85 0.17
86 0.17
87 0.18
88 0.21
89 0.23
90 0.21
91 0.23
92 0.2
93 0.18
94 0.2
95 0.2
96 0.18
97 0.19
98 0.2
99 0.18
100 0.2
101 0.19
102 0.18
103 0.21
104 0.21
105 0.18
106 0.17
107 0.15
108 0.14
109 0.14
110 0.14
111 0.09
112 0.08
113 0.09
114 0.11
115 0.15
116 0.15
117 0.15
118 0.16
119 0.18
120 0.18
121 0.18
122 0.16
123 0.18
124 0.19
125 0.22
126 0.21
127 0.23
128 0.24
129 0.26
130 0.27
131 0.24
132 0.23
133 0.2
134 0.25
135 0.23
136 0.24
137 0.23
138 0.22
139 0.19
140 0.23
141 0.29
142 0.3
143 0.35
144 0.36
145 0.37
146 0.38
147 0.41
148 0.38
149 0.35
150 0.29
151 0.24
152 0.21
153 0.2
154 0.2