Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D8PUL1

Protein Details
Accession D8PUL1    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
145-164ATVIYMDRVKRRRDRKESTIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto 7, mito 1, extr 1, golg 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR046528  DUF6593  
KEGG scm:SCHCO_02660745  -  
Pfam View protein in Pfam  
PF20236  DUF6593  
Amino Acid Sequences MDFELSDHDFYNTVLLDSTSHRAAYRTSTKLFQVGKRSTTLYRAAPDQPSGEVLIGTVMLRAFSSHEVVVNGRDVTPVRMGLFSRSETWLASDGRQYKWKVDPGVFTLVDDQTKEMIALFERHFFSTNKLCILPKGMHFVDEIVATVIYMDRVKRRRDRKESTI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.1
4 0.13
5 0.16
6 0.15
7 0.16
8 0.16
9 0.16
10 0.18
11 0.24
12 0.29
13 0.3
14 0.32
15 0.34
16 0.35
17 0.41
18 0.44
19 0.42
20 0.43
21 0.42
22 0.42
23 0.42
24 0.43
25 0.38
26 0.37
27 0.36
28 0.3
29 0.28
30 0.29
31 0.3
32 0.29
33 0.29
34 0.26
35 0.22
36 0.2
37 0.18
38 0.15
39 0.11
40 0.08
41 0.07
42 0.06
43 0.05
44 0.05
45 0.04
46 0.04
47 0.04
48 0.04
49 0.06
50 0.06
51 0.08
52 0.08
53 0.09
54 0.09
55 0.1
56 0.1
57 0.1
58 0.1
59 0.08
60 0.09
61 0.08
62 0.09
63 0.1
64 0.09
65 0.08
66 0.09
67 0.09
68 0.11
69 0.12
70 0.12
71 0.12
72 0.13
73 0.13
74 0.12
75 0.13
76 0.14
77 0.13
78 0.13
79 0.16
80 0.17
81 0.19
82 0.25
83 0.24
84 0.25
85 0.29
86 0.32
87 0.31
88 0.3
89 0.3
90 0.28
91 0.32
92 0.29
93 0.24
94 0.22
95 0.2
96 0.19
97 0.17
98 0.14
99 0.09
100 0.09
101 0.09
102 0.07
103 0.07
104 0.07
105 0.11
106 0.11
107 0.15
108 0.17
109 0.18
110 0.2
111 0.2
112 0.24
113 0.27
114 0.28
115 0.27
116 0.27
117 0.27
118 0.26
119 0.3
120 0.29
121 0.24
122 0.29
123 0.27
124 0.26
125 0.25
126 0.25
127 0.21
128 0.18
129 0.16
130 0.09
131 0.09
132 0.08
133 0.08
134 0.07
135 0.07
136 0.09
137 0.12
138 0.2
139 0.26
140 0.35
141 0.45
142 0.56
143 0.65
144 0.74