Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D8PQJ5

Protein Details
Accession D8PQJ5    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
168-192LTHGEGDKRERKRKPGKTSSLDSVCHydrophilic
NLS Segment(s)
PositionSequence
175-184KRERKRKPGK
Subcellular Location(s) nucl 16.5, cyto_nucl 11.5, cyto 5.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001766  Fork_head_dom  
IPR036388  WH-like_DNA-bd_sf  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003700  F:DNA-binding transcription factor activity  
GO:0043565  F:sequence-specific DNA binding  
KEGG scm:SCHCO_02257898  -  
Pfam View protein in Pfam  
PF00250  Forkhead  
PROSITE View protein in PROSITE  
PS50039  FORK_HEAD_3  
CDD cd00059  FH_FOX  
Amino Acid Sequences MSNGFHGYPQADRRNVHNSTYDSPSRGNALTPQAARFAASTSYIAYTCRDPVTDRALDALNEQYLRRRLRSLGVDGAISLWTLPDFPPDVKPPIEYPILVMVALYAAPTKKLQLQEIYDAIMERYPFFRSAPSWQESIRHLLSLKIQFRHIDRPIGVQGRGGYWYLDLTHGEGDKRERKRKPGKTSSLDSVCDDACSDHAWV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.5
3 0.47
4 0.46
5 0.42
6 0.42
7 0.47
8 0.45
9 0.39
10 0.38
11 0.36
12 0.33
13 0.28
14 0.25
15 0.22
16 0.25
17 0.28
18 0.28
19 0.28
20 0.27
21 0.26
22 0.25
23 0.21
24 0.17
25 0.13
26 0.13
27 0.12
28 0.11
29 0.13
30 0.12
31 0.13
32 0.13
33 0.13
34 0.14
35 0.14
36 0.14
37 0.15
38 0.18
39 0.24
40 0.23
41 0.22
42 0.21
43 0.21
44 0.21
45 0.2
46 0.17
47 0.12
48 0.12
49 0.12
50 0.16
51 0.22
52 0.24
53 0.24
54 0.25
55 0.25
56 0.3
57 0.34
58 0.33
59 0.3
60 0.28
61 0.26
62 0.24
63 0.23
64 0.17
65 0.13
66 0.08
67 0.04
68 0.03
69 0.04
70 0.04
71 0.05
72 0.06
73 0.07
74 0.11
75 0.13
76 0.16
77 0.16
78 0.17
79 0.16
80 0.18
81 0.18
82 0.15
83 0.13
84 0.13
85 0.13
86 0.11
87 0.1
88 0.06
89 0.06
90 0.05
91 0.05
92 0.03
93 0.03
94 0.04
95 0.05
96 0.06
97 0.09
98 0.11
99 0.13
100 0.16
101 0.18
102 0.2
103 0.2
104 0.2
105 0.17
106 0.15
107 0.14
108 0.11
109 0.09
110 0.07
111 0.08
112 0.09
113 0.1
114 0.1
115 0.11
116 0.12
117 0.18
118 0.23
119 0.24
120 0.24
121 0.24
122 0.26
123 0.26
124 0.3
125 0.25
126 0.21
127 0.18
128 0.18
129 0.24
130 0.29
131 0.32
132 0.28
133 0.3
134 0.31
135 0.35
136 0.42
137 0.38
138 0.36
139 0.32
140 0.34
141 0.38
142 0.39
143 0.36
144 0.29
145 0.27
146 0.23
147 0.24
148 0.2
149 0.14
150 0.11
151 0.12
152 0.1
153 0.11
154 0.1
155 0.1
156 0.12
157 0.13
158 0.14
159 0.15
160 0.22
161 0.29
162 0.39
163 0.47
164 0.51
165 0.61
166 0.71
167 0.79
168 0.83
169 0.85
170 0.86
171 0.85
172 0.85
173 0.84
174 0.79
175 0.71
176 0.62
177 0.54
178 0.43
179 0.36
180 0.29
181 0.2
182 0.16