Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q0UAG8

Protein Details
Accession Q0UAG8    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
59-79IKNYADHKRRHHKQMDKTVEIBasic
NLS Segment(s)
Subcellular Location(s) nucl 15, mito 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR030379  G_SEPTIN_dom  
IPR027417  P-loop_NTPase  
IPR016491  Septin  
Gene Ontology GO:0005621  C:cellular bud scar  
GO:1990317  C:Gin4 complex  
GO:0005937  C:mating projection  
GO:0031105  C:septin complex  
GO:0032160  C:septin filament array  
GO:0005525  F:GTP binding  
GO:0003924  F:GTPase activity  
GO:0060090  F:molecular adaptor activity  
GO:0070273  F:phosphatidylinositol-4-phosphate binding  
GO:0010314  F:phosphatidylinositol-5-phosphate binding  
GO:0005200  F:structural constituent of cytoskeleton  
GO:0030011  P:maintenance of cell polarity  
GO:1903475  P:mitotic actomyosin contractile ring assembly  
GO:0071902  P:positive regulation of protein serine/threonine kinase activity  
GO:0000921  P:septin ring assembly  
KEGG pno:SNOG_11246  -  
Pfam View protein in Pfam  
PF00735  Septin  
PROSITE View protein in PROSITE  
PS51719  G_SEPTIN  
Amino Acid Sequences MAENLSPIGIANVRILPINMSRSTEANMHCSCPTRVSQVAGESGLGKTTFINTLFSTTIKNYADHKRRHHKQMDKTVEIEITKAELEEKFFKVRLTVIDTPGFGDYVNNRDSWQPIIEFLDDQHESYMLQEQQPRRTDKIDLRVHACLYFIRPTGHTLKPLDIEVMKKLCTRVNLIPVVAKADTLSPADLFKFKQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.14
4 0.16
5 0.2
6 0.19
7 0.22
8 0.23
9 0.24
10 0.26
11 0.28
12 0.26
13 0.28
14 0.28
15 0.27
16 0.28
17 0.3
18 0.29
19 0.27
20 0.27
21 0.26
22 0.27
23 0.27
24 0.28
25 0.26
26 0.27
27 0.24
28 0.22
29 0.17
30 0.15
31 0.14
32 0.11
33 0.09
34 0.08
35 0.09
36 0.11
37 0.1
38 0.13
39 0.11
40 0.14
41 0.15
42 0.15
43 0.16
44 0.14
45 0.19
46 0.17
47 0.19
48 0.21
49 0.31
50 0.39
51 0.44
52 0.53
53 0.59
54 0.65
55 0.73
56 0.78
57 0.76
58 0.78
59 0.82
60 0.81
61 0.72
62 0.66
63 0.57
64 0.5
65 0.41
66 0.31
67 0.2
68 0.12
69 0.09
70 0.08
71 0.08
72 0.06
73 0.09
74 0.12
75 0.13
76 0.14
77 0.15
78 0.15
79 0.14
80 0.15
81 0.14
82 0.18
83 0.18
84 0.19
85 0.19
86 0.19
87 0.19
88 0.19
89 0.17
90 0.1
91 0.09
92 0.07
93 0.09
94 0.1
95 0.09
96 0.1
97 0.11
98 0.12
99 0.13
100 0.13
101 0.1
102 0.1
103 0.12
104 0.12
105 0.11
106 0.1
107 0.14
108 0.13
109 0.13
110 0.12
111 0.1
112 0.1
113 0.1
114 0.15
115 0.11
116 0.13
117 0.18
118 0.21
119 0.28
120 0.34
121 0.38
122 0.36
123 0.37
124 0.41
125 0.42
126 0.49
127 0.49
128 0.46
129 0.46
130 0.46
131 0.45
132 0.39
133 0.33
134 0.24
135 0.2
136 0.2
137 0.18
138 0.17
139 0.17
140 0.21
141 0.27
142 0.28
143 0.3
144 0.29
145 0.3
146 0.3
147 0.29
148 0.28
149 0.24
150 0.24
151 0.25
152 0.25
153 0.24
154 0.24
155 0.25
156 0.26
157 0.27
158 0.31
159 0.31
160 0.36
161 0.37
162 0.36
163 0.37
164 0.35
165 0.36
166 0.29
167 0.24
168 0.17
169 0.15
170 0.16
171 0.15
172 0.15
173 0.12
174 0.14
175 0.16
176 0.18