Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

D8PKI4

Protein Details
Accession D8PKI4    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MAKSLRSKVKRSFRNKKREDSVYAHydrophilic
NLS Segment(s)
PositionSequence
8-17KVKRSFRNKK
88-132HGPRGSRREEWRLSKGMPARPKSKGLNRQGGIAARVRPGRPKRRR
Subcellular Location(s) nucl 16.5, cyto_nucl 11.5, cyto 5.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSLRSKVKRSFRNKKREDSVYAATEAARLERLNAKLRNTIATDADGDVAIADEEDRRKDDIPGADGSMDVDGAPKQTTASKRVSTHGPRGSRREEWRLSKGMPARPKSKGLNRQGGIAARVRPGRPKRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.88
3 0.88
4 0.86
5 0.83
6 0.78
7 0.74
8 0.7
9 0.61
10 0.54
11 0.45
12 0.36
13 0.3
14 0.23
15 0.17
16 0.12
17 0.09
18 0.1
19 0.16
20 0.19
21 0.27
22 0.3
23 0.32
24 0.35
25 0.36
26 0.37
27 0.33
28 0.31
29 0.24
30 0.22
31 0.2
32 0.16
33 0.15
34 0.11
35 0.09
36 0.07
37 0.06
38 0.05
39 0.03
40 0.03
41 0.04
42 0.05
43 0.07
44 0.08
45 0.09
46 0.1
47 0.11
48 0.15
49 0.15
50 0.16
51 0.16
52 0.15
53 0.14
54 0.13
55 0.12
56 0.08
57 0.07
58 0.04
59 0.04
60 0.04
61 0.05
62 0.05
63 0.05
64 0.05
65 0.1
66 0.13
67 0.16
68 0.21
69 0.25
70 0.27
71 0.29
72 0.37
73 0.38
74 0.45
75 0.48
76 0.5
77 0.51
78 0.55
79 0.58
80 0.57
81 0.58
82 0.58
83 0.58
84 0.58
85 0.58
86 0.57
87 0.52
88 0.51
89 0.51
90 0.5
91 0.51
92 0.51
93 0.51
94 0.51
95 0.56
96 0.58
97 0.62
98 0.65
99 0.66
100 0.7
101 0.65
102 0.64
103 0.62
104 0.56
105 0.49
106 0.44
107 0.37
108 0.32
109 0.36
110 0.34
111 0.41
112 0.48