Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

D8PTF5

Protein Details
Accession D8PTF5    Localization Confidence High Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
46-69DDPRKALRAKRRIETKQRIKDENFBasic
NLS Segment(s)
PositionSequence
49-57RKALRAKRR
Subcellular Location(s) nucl 21, cyto 3.5, cyto_mito 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG scm:SCHCO_01198128  -  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences APKSSCPADTVLVGLNYLKGQPPVLAKPDEEYPEWLWTILEPKVHDDPRKALRAKRRIETKQRIKDENFMSTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.12
3 0.1
4 0.1
5 0.11
6 0.09
7 0.09
8 0.11
9 0.14
10 0.16
11 0.2
12 0.2
13 0.19
14 0.2
15 0.23
16 0.23
17 0.21
18 0.21
19 0.19
20 0.19
21 0.19
22 0.17
23 0.13
24 0.11
25 0.13
26 0.11
27 0.11
28 0.1
29 0.14
30 0.2
31 0.23
32 0.26
33 0.26
34 0.31
35 0.36
36 0.44
37 0.43
38 0.43
39 0.5
40 0.57
41 0.61
42 0.63
43 0.67
44 0.69
45 0.77
46 0.82
47 0.83
48 0.84
49 0.85
50 0.84
51 0.78
52 0.76
53 0.7