Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

D8Q756

Protein Details
Accession D8Q756    Localization Confidence High Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MSSKLKNKLKQTKFPVARIKKIMHydrophilic
153-243DSDEEKPKPKRARKPREPKEPKPKKDPKPKVPKAPKEPKPPKEPKPPKEPKPKKEAKPRAPRKTKVENGDGEEAPKRRRRKKADEPEAMGEBasic
NLS Segment(s)
PositionSequence
108-118KRRGKGKARAR
158-235KPKPKRARKPREPKEPKPKKDPKPKVPKAPKEPKPPKEPKPPKEPKPKKEAKPRAPRKTKVENGDGEEAPKRRRRKKA
Subcellular Location(s) nucl 16.5, cyto_nucl 11, mito 6, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003958  CBFA_NFYB_domain  
IPR009072  Histone-fold  
Gene Ontology GO:0046982  F:protein heterodimerization activity  
KEGG scm:SCHCO_02629676  -  
Pfam View protein in Pfam  
PF00808  CBFD_NFYB_HMF  
Amino Acid Sequences MSSKLKNKLKQTKFPVARIKKIMQKDDDVGKVAQATPVVISKALELFLKTIVDESAKVTLQRGAKKVEAYHLKHAVETVEVLDFLKDIVAGVPDPSAGGTIDPHENSKRRGKGKARARAAAAGDDDEEGDGNDGDVHMASAHTDEDGEGGDGDSDEEKPKPKRARKPREPKEPKPKKDPKPKVPKAPKEPKPPKEPKPPKEPKPKKEAKPRAPRKTKVENGDGEEAPKRRRRKKADEPEAMGEGMGSFALEPPGGYVQTYEQQAQAYDAGASNYDAGAGEYEAGASTYASGGGYDDEDSNGYHAAPTGSAYEDAYGGREHMYAEPSGYAPAAHDSAMYGMETFPEDDRPYMPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.84
3 0.82
4 0.81
5 0.78
6 0.77
7 0.74
8 0.75
9 0.74
10 0.68
11 0.65
12 0.62
13 0.62
14 0.57
15 0.52
16 0.44
17 0.36
18 0.33
19 0.28
20 0.23
21 0.17
22 0.14
23 0.12
24 0.14
25 0.14
26 0.13
27 0.12
28 0.12
29 0.13
30 0.13
31 0.13
32 0.11
33 0.11
34 0.12
35 0.12
36 0.11
37 0.11
38 0.11
39 0.11
40 0.11
41 0.12
42 0.14
43 0.15
44 0.15
45 0.15
46 0.2
47 0.24
48 0.3
49 0.32
50 0.32
51 0.34
52 0.37
53 0.38
54 0.42
55 0.46
56 0.44
57 0.49
58 0.51
59 0.48
60 0.45
61 0.44
62 0.35
63 0.26
64 0.22
65 0.15
66 0.09
67 0.09
68 0.09
69 0.08
70 0.07
71 0.06
72 0.06
73 0.04
74 0.04
75 0.04
76 0.05
77 0.05
78 0.06
79 0.06
80 0.06
81 0.06
82 0.06
83 0.06
84 0.05
85 0.05
86 0.05
87 0.07
88 0.1
89 0.11
90 0.14
91 0.19
92 0.23
93 0.28
94 0.36
95 0.41
96 0.43
97 0.52
98 0.58
99 0.62
100 0.69
101 0.73
102 0.7
103 0.66
104 0.63
105 0.58
106 0.51
107 0.44
108 0.34
109 0.25
110 0.19
111 0.16
112 0.14
113 0.09
114 0.08
115 0.05
116 0.05
117 0.04
118 0.04
119 0.04
120 0.04
121 0.04
122 0.04
123 0.04
124 0.03
125 0.03
126 0.03
127 0.04
128 0.04
129 0.04
130 0.04
131 0.04
132 0.04
133 0.04
134 0.04
135 0.04
136 0.04
137 0.04
138 0.04
139 0.04
140 0.04
141 0.05
142 0.06
143 0.07
144 0.13
145 0.15
146 0.23
147 0.32
148 0.41
149 0.51
150 0.61
151 0.71
152 0.77
153 0.86
154 0.89
155 0.91
156 0.92
157 0.91
158 0.92
159 0.91
160 0.86
161 0.86
162 0.86
163 0.84
164 0.86
165 0.86
166 0.85
167 0.86
168 0.87
169 0.87
170 0.88
171 0.87
172 0.86
173 0.86
174 0.84
175 0.84
176 0.87
177 0.83
178 0.83
179 0.82
180 0.8
181 0.81
182 0.83
183 0.79
184 0.8
185 0.83
186 0.82
187 0.85
188 0.86
189 0.82
190 0.82
191 0.85
192 0.83
193 0.85
194 0.86
195 0.85
196 0.86
197 0.9
198 0.9
199 0.9
200 0.87
201 0.84
202 0.83
203 0.8
204 0.75
205 0.7
206 0.63
207 0.58
208 0.56
209 0.47
210 0.39
211 0.37
212 0.33
213 0.32
214 0.36
215 0.4
216 0.45
217 0.55
218 0.63
219 0.69
220 0.77
221 0.83
222 0.87
223 0.86
224 0.82
225 0.75
226 0.67
227 0.56
228 0.44
229 0.32
230 0.21
231 0.13
232 0.08
233 0.04
234 0.03
235 0.03
236 0.04
237 0.04
238 0.04
239 0.05
240 0.07
241 0.07
242 0.07
243 0.07
244 0.09
245 0.13
246 0.15
247 0.15
248 0.14
249 0.15
250 0.15
251 0.16
252 0.14
253 0.11
254 0.09
255 0.09
256 0.08
257 0.08
258 0.08
259 0.07
260 0.07
261 0.06
262 0.06
263 0.05
264 0.06
265 0.05
266 0.05
267 0.05
268 0.05
269 0.05
270 0.05
271 0.05
272 0.04
273 0.04
274 0.04
275 0.05
276 0.05
277 0.05
278 0.05
279 0.05
280 0.07
281 0.07
282 0.08
283 0.08
284 0.09
285 0.09
286 0.1
287 0.09
288 0.09
289 0.07
290 0.08
291 0.08
292 0.08
293 0.09
294 0.09
295 0.1
296 0.11
297 0.11
298 0.11
299 0.11
300 0.11
301 0.11
302 0.1
303 0.09
304 0.1
305 0.1
306 0.11
307 0.12
308 0.14
309 0.13
310 0.14
311 0.15
312 0.14
313 0.15
314 0.13
315 0.11
316 0.1
317 0.13
318 0.13
319 0.11
320 0.11
321 0.1
322 0.11
323 0.12
324 0.11
325 0.08
326 0.07
327 0.08
328 0.1
329 0.11
330 0.11
331 0.15
332 0.16
333 0.17