Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D8PPK6

Protein Details
Accession D8PPK6    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
143-168QGKGTAKKGKRGWKRKGGSGRPLKVHBasic
NLS Segment(s)
PositionSequence
136-168KHNSKGAQGKGTAKKGKRGWKRKGGSGRPLKVH
Subcellular Location(s) mito 18.5, cyto_mito 11.5, cyto 3.5, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR003822  PAH  
IPR036600  PAH_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0006355  P:regulation of DNA-templated transcription  
KEGG scm:SCHCO_02538544  -  
PROSITE View protein in PROSITE  
PS51477  PAH  
Amino Acid Sequences MPPRRVVAVSEPATSPLAWPKINDPFAQKVIDAATFADLVRTSFADEPERYRQFFDMMLWHERHPLNVKGLGHRAMQVFAGHPDLISGLRVVCPKLPGPKKGTSEQRRGGHLDALMKERFREQPEKYQRLRDIADKHNSKGAQGKGTAKKGKRGWKRKGGSGRPLKVHEEEKSKVEKDGQVEAPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.24
3 0.22
4 0.24
5 0.23
6 0.24
7 0.27
8 0.35
9 0.38
10 0.39
11 0.37
12 0.38
13 0.39
14 0.39
15 0.33
16 0.25
17 0.24
18 0.22
19 0.17
20 0.12
21 0.11
22 0.1
23 0.1
24 0.1
25 0.08
26 0.08
27 0.09
28 0.09
29 0.1
30 0.11
31 0.13
32 0.17
33 0.18
34 0.23
35 0.31
36 0.34
37 0.32
38 0.32
39 0.31
40 0.27
41 0.27
42 0.23
43 0.19
44 0.19
45 0.23
46 0.23
47 0.23
48 0.27
49 0.26
50 0.28
51 0.27
52 0.26
53 0.24
54 0.27
55 0.27
56 0.25
57 0.28
58 0.28
59 0.24
60 0.24
61 0.21
62 0.18
63 0.17
64 0.14
65 0.12
66 0.1
67 0.11
68 0.09
69 0.08
70 0.07
71 0.07
72 0.07
73 0.06
74 0.05
75 0.04
76 0.06
77 0.07
78 0.07
79 0.08
80 0.09
81 0.11
82 0.2
83 0.24
84 0.27
85 0.32
86 0.38
87 0.41
88 0.46
89 0.55
90 0.53
91 0.58
92 0.61
93 0.59
94 0.55
95 0.54
96 0.48
97 0.4
98 0.34
99 0.3
100 0.23
101 0.24
102 0.23
103 0.2
104 0.2
105 0.2
106 0.23
107 0.24
108 0.29
109 0.29
110 0.39
111 0.49
112 0.57
113 0.57
114 0.61
115 0.59
116 0.56
117 0.55
118 0.51
119 0.48
120 0.47
121 0.54
122 0.5
123 0.48
124 0.49
125 0.47
126 0.41
127 0.42
128 0.37
129 0.32
130 0.32
131 0.4
132 0.41
133 0.5
134 0.57
135 0.52
136 0.58
137 0.61
138 0.67
139 0.7
140 0.73
141 0.75
142 0.77
143 0.81
144 0.81
145 0.85
146 0.84
147 0.83
148 0.83
149 0.8
150 0.76
151 0.74
152 0.69
153 0.64
154 0.61
155 0.57
156 0.53
157 0.49
158 0.48
159 0.51
160 0.47
161 0.45
162 0.44
163 0.42
164 0.39
165 0.44