Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

D8PWG8

Protein Details
Accession D8PWG8    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MTIHIKNIKVRPKKKIQRTPCIYQLNSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR017264  Ribosomal_MRP10_mt  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG scm:SCHCO_02606599  -  
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MTIHIKNIKVRPKKKIQRTPCIYQLNSMLGCWAAHGDLMSTNECASHATMLFECMRTMPPAKPQHKPTINYHLSRLGNRIQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.87
3 0.87
4 0.87
5 0.87
6 0.85
7 0.83
8 0.8
9 0.7
10 0.61
11 0.54
12 0.46
13 0.39
14 0.31
15 0.22
16 0.14
17 0.14
18 0.11
19 0.09
20 0.05
21 0.04
22 0.04
23 0.04
24 0.05
25 0.07
26 0.07
27 0.07
28 0.07
29 0.07
30 0.07
31 0.08
32 0.07
33 0.06
34 0.06
35 0.07
36 0.07
37 0.09
38 0.1
39 0.1
40 0.09
41 0.09
42 0.1
43 0.12
44 0.14
45 0.14
46 0.23
47 0.33
48 0.38
49 0.45
50 0.5
51 0.59
52 0.64
53 0.66
54 0.64
55 0.65
56 0.68
57 0.62
58 0.6
59 0.57
60 0.53
61 0.51