Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0UG28

Protein Details
Accession Q0UG28   
Localization Confidence High
Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
48-68QKSFRTKQKLARAQKQNRPIPHydrophilic
74-95RTNNTIRYNAKRRHWRKTRLGIHydrophilic
NLS Segment(s)
PositionSequence
84-90KRRHWRK
Subcellular Location(s) nucl 15, mito 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR000077  Ribosomal_L39  
IPR023626  Ribosomal_L39e_dom_sf  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG pno:SNOG_09286  -  
Pfam View protein in Pfam  
PF00832  Ribosomal_L39  
Amino Acid Sequences MFCIGVLPACWTWHTTQANTRINILSSLIDPNDNNFDIPTPVVTMPSQKSFRTKQKLARAQKQNRPIPQWIRLRTNNTIRYNAKRRHWRKTRLGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.27
3 0.32
4 0.41
5 0.47
6 0.46
7 0.46
8 0.39
9 0.36
10 0.33
11 0.28
12 0.19
13 0.13
14 0.14
15 0.12
16 0.12
17 0.11
18 0.12
19 0.15
20 0.14
21 0.13
22 0.12
23 0.12
24 0.11
25 0.11
26 0.1
27 0.08
28 0.08
29 0.09
30 0.09
31 0.11
32 0.12
33 0.17
34 0.19
35 0.18
36 0.24
37 0.29
38 0.38
39 0.43
40 0.47
41 0.5
42 0.59
43 0.68
44 0.72
45 0.75
46 0.77
47 0.78
48 0.81
49 0.82
50 0.79
51 0.75
52 0.72
53 0.7
54 0.65
55 0.64
56 0.65
57 0.61
58 0.62
59 0.62
60 0.63
61 0.63
62 0.67
63 0.67
64 0.62
65 0.64
66 0.62
67 0.66
68 0.69
69 0.7
70 0.7
71 0.72
72 0.76
73 0.79
74 0.84
75 0.85