Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D8Q9K7

Protein Details
Accession D8Q9K7   
Localization Confidence High
Confidence Score 20.9
NoLS Segment(s)
PositionSequenceProtein Nature
292-317YDDGSKKPAYKKRPDKRYVPVIKKERBasic
331-354KSERRRDRSYSPRRSDREDRRGDRBasic
375-394KYREDKYKDRDDKYRDRDSKBasic
406-438REDSSRRKEKDYHDDRERRRDRSRDATRRRRDYBasic
NLS Segment(s)
PositionSequence
85-98RRSVRDKAKAAPKG
297-362KKPAYKKRPDKRYVPVIKKEREESQPRNDRERDGKSERRRDRSYSPRRSDREDRRGDRDDKYRSRD
410-436SRRKEKDYHDDRERRRDRSRDATRRRR
Subcellular Location(s) nucl 12.5, mito 12, cyto_nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000467  G_patch_dom  
IPR045166  Spp2-like  
IPR026822  Spp2/MOS2_G-patch  
Gene Ontology GO:0005634  C:nucleus  
GO:0003676  F:nucleic acid binding  
GO:0000398  P:mRNA splicing, via spliceosome  
Pfam View protein in Pfam  
PF12656  G-patch_2  
PROSITE View protein in PROSITE  
PS50174  G_PATCH  
Amino Acid Sequences MSQKVSFTVRRPTPVSRDNSSGPESDGSGFKVPGLPRHLKNESVPGSPLAQSASTSPRRYIDSSDEEDEEAVELVDEFDKIGGARRSVRDKAKAAPKGPLVIQPAPNRDWRELARRRRGQFVPASAAATTGADGSVGGLGTRDTINTGPVLAGLQVKHREVKVEGDDVTVKEEEETTAMAVDEETDDQKALRAILATADGRTQEDGPVIDVIRPVSEAEALKQDVDELPDQATLEDYERVPVSQFGAALLRGMGWKEGMAATRKPGRGMVEPYMPEARPALLGIGAKEQEVYDDGSKKPAYKKRPDKRYVPVIKKEREESQPRNDRERDGKSERRRDRSYSPRRSDREDRRGDRDDKYRSRDRDRDDKYRDRDDKYREDKYKDRDDKYRDRDSKYRDRDDSKYREREDSSRRKEKDYHDDRERRRDRSRDATRRRRDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.64
3 0.59
4 0.6
5 0.57
6 0.57
7 0.53
8 0.45
9 0.39
10 0.33
11 0.3
12 0.26
13 0.24
14 0.22
15 0.22
16 0.2
17 0.18
18 0.23
19 0.22
20 0.27
21 0.33
22 0.37
23 0.39
24 0.48
25 0.51
26 0.49
27 0.51
28 0.54
29 0.5
30 0.45
31 0.42
32 0.35
33 0.35
34 0.31
35 0.29
36 0.21
37 0.17
38 0.15
39 0.17
40 0.23
41 0.28
42 0.29
43 0.31
44 0.32
45 0.36
46 0.38
47 0.39
48 0.39
49 0.39
50 0.42
51 0.43
52 0.41
53 0.37
54 0.34
55 0.3
56 0.22
57 0.15
58 0.1
59 0.06
60 0.05
61 0.06
62 0.06
63 0.06
64 0.05
65 0.05
66 0.05
67 0.06
68 0.12
69 0.14
70 0.16
71 0.21
72 0.27
73 0.34
74 0.4
75 0.47
76 0.48
77 0.49
78 0.55
79 0.6
80 0.62
81 0.57
82 0.57
83 0.52
84 0.48
85 0.46
86 0.43
87 0.4
88 0.37
89 0.42
90 0.41
91 0.43
92 0.42
93 0.47
94 0.45
95 0.4
96 0.4
97 0.38
98 0.43
99 0.48
100 0.56
101 0.61
102 0.65
103 0.66
104 0.7
105 0.68
106 0.65
107 0.61
108 0.55
109 0.5
110 0.43
111 0.41
112 0.33
113 0.31
114 0.24
115 0.17
116 0.13
117 0.07
118 0.05
119 0.04
120 0.04
121 0.04
122 0.04
123 0.04
124 0.04
125 0.04
126 0.04
127 0.05
128 0.05
129 0.05
130 0.06
131 0.06
132 0.07
133 0.07
134 0.07
135 0.06
136 0.06
137 0.07
138 0.06
139 0.08
140 0.07
141 0.12
142 0.14
143 0.16
144 0.18
145 0.18
146 0.2
147 0.19
148 0.23
149 0.21
150 0.21
151 0.21
152 0.2
153 0.21
154 0.19
155 0.2
156 0.15
157 0.12
158 0.1
159 0.1
160 0.08
161 0.07
162 0.07
163 0.05
164 0.05
165 0.05
166 0.05
167 0.04
168 0.04
169 0.04
170 0.05
171 0.05
172 0.05
173 0.05
174 0.05
175 0.06
176 0.07
177 0.06
178 0.06
179 0.06
180 0.05
181 0.06
182 0.08
183 0.07
184 0.07
185 0.08
186 0.08
187 0.08
188 0.09
189 0.08
190 0.07
191 0.07
192 0.07
193 0.07
194 0.08
195 0.08
196 0.07
197 0.08
198 0.07
199 0.07
200 0.07
201 0.06
202 0.05
203 0.07
204 0.07
205 0.07
206 0.1
207 0.1
208 0.09
209 0.09
210 0.09
211 0.08
212 0.1
213 0.09
214 0.07
215 0.08
216 0.08
217 0.08
218 0.08
219 0.08
220 0.06
221 0.07
222 0.08
223 0.07
224 0.08
225 0.08
226 0.08
227 0.08
228 0.08
229 0.08
230 0.08
231 0.08
232 0.07
233 0.08
234 0.08
235 0.07
236 0.07
237 0.06
238 0.05
239 0.05
240 0.05
241 0.04
242 0.04
243 0.05
244 0.06
245 0.08
246 0.11
247 0.11
248 0.15
249 0.21
250 0.22
251 0.22
252 0.23
253 0.24
254 0.26
255 0.3
256 0.29
257 0.28
258 0.28
259 0.3
260 0.3
261 0.27
262 0.23
263 0.19
264 0.16
265 0.11
266 0.11
267 0.09
268 0.08
269 0.08
270 0.08
271 0.11
272 0.1
273 0.1
274 0.1
275 0.1
276 0.08
277 0.09
278 0.11
279 0.11
280 0.14
281 0.14
282 0.19
283 0.2
284 0.23
285 0.31
286 0.36
287 0.43
288 0.51
289 0.62
290 0.67
291 0.78
292 0.81
293 0.8
294 0.81
295 0.83
296 0.82
297 0.8
298 0.8
299 0.78
300 0.77
301 0.74
302 0.69
303 0.64
304 0.62
305 0.63
306 0.6
307 0.61
308 0.65
309 0.65
310 0.69
311 0.65
312 0.62
313 0.61
314 0.61
315 0.59
316 0.58
317 0.64
318 0.66
319 0.74
320 0.78
321 0.78
322 0.76
323 0.74
324 0.75
325 0.76
326 0.77
327 0.78
328 0.78
329 0.79
330 0.79
331 0.81
332 0.82
333 0.81
334 0.81
335 0.8
336 0.77
337 0.75
338 0.79
339 0.75
340 0.71
341 0.69
342 0.69
343 0.66
344 0.69
345 0.7
346 0.69
347 0.75
348 0.75
349 0.74
350 0.75
351 0.74
352 0.77
353 0.77
354 0.79
355 0.76
356 0.79
357 0.78
358 0.74
359 0.75
360 0.72
361 0.74
362 0.72
363 0.75
364 0.72
365 0.72
366 0.74
367 0.74
368 0.77
369 0.76
370 0.74
371 0.73
372 0.75
373 0.78
374 0.78
375 0.81
376 0.77
377 0.75
378 0.77
379 0.77
380 0.79
381 0.78
382 0.79
383 0.76
384 0.76
385 0.76
386 0.78
387 0.79
388 0.78
389 0.78
390 0.73
391 0.72
392 0.7
393 0.71
394 0.72
395 0.73
396 0.73
397 0.74
398 0.73
399 0.72
400 0.75
401 0.75
402 0.76
403 0.74
404 0.74
405 0.74
406 0.81
407 0.83
408 0.86
409 0.85
410 0.82
411 0.82
412 0.81
413 0.79
414 0.8
415 0.84
416 0.83
417 0.87
418 0.9