Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D8PNT6

Protein Details
Accession D8PNT6   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
8-28TPEEREKKDREDRERERQEQAAcidic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 12.833, cyto 5, cyto_pero 3.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR007052  CS_dom  
IPR008978  HSP20-like_chaperone  
IPR037898  NudC_fam  
KEGG scm:SCHCO_02612276  -  
Pfam View protein in Pfam  
PF04969  CS  
PROSITE View protein in PROSITE  
PS51203  CS  
CDD cd06467  p23_NUDC_like  
Amino Acid Sequences MDDYDKLTPEEREKKDREDRERERQEQATLPYSWTQELSDVDVTVPVPPGTRGRDLVVEIKKKRLSVGLKGQPKILEGELCKEIKVEDSTWTLEDNKLVLIHLEKLNKQTWWENVLTHHPKIDTTKIVPPNSSLSELDGETRGMVEKMMYDNQQKQMGKPTSDEQKKAEALAKFQAAHPELDFSNAKIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.68
3 0.74
4 0.74
5 0.75
6 0.77
7 0.79
8 0.85
9 0.8
10 0.77
11 0.7
12 0.64
13 0.58
14 0.54
15 0.48
16 0.38
17 0.36
18 0.32
19 0.3
20 0.27
21 0.23
22 0.18
23 0.16
24 0.16
25 0.17
26 0.15
27 0.14
28 0.13
29 0.13
30 0.13
31 0.11
32 0.11
33 0.08
34 0.08
35 0.09
36 0.13
37 0.16
38 0.18
39 0.19
40 0.2
41 0.21
42 0.23
43 0.29
44 0.32
45 0.37
46 0.36
47 0.41
48 0.42
49 0.4
50 0.39
51 0.39
52 0.36
53 0.35
54 0.44
55 0.46
56 0.5
57 0.51
58 0.51
59 0.44
60 0.41
61 0.35
62 0.25
63 0.2
64 0.14
65 0.16
66 0.18
67 0.18
68 0.17
69 0.15
70 0.14
71 0.14
72 0.15
73 0.12
74 0.11
75 0.13
76 0.13
77 0.14
78 0.15
79 0.13
80 0.12
81 0.11
82 0.09
83 0.07
84 0.07
85 0.06
86 0.06
87 0.06
88 0.08
89 0.11
90 0.13
91 0.14
92 0.17
93 0.19
94 0.19
95 0.2
96 0.2
97 0.2
98 0.22
99 0.22
100 0.19
101 0.2
102 0.29
103 0.31
104 0.28
105 0.28
106 0.24
107 0.24
108 0.27
109 0.28
110 0.23
111 0.21
112 0.29
113 0.34
114 0.35
115 0.34
116 0.33
117 0.33
118 0.32
119 0.31
120 0.24
121 0.19
122 0.19
123 0.19
124 0.18
125 0.15
126 0.13
127 0.1
128 0.1
129 0.09
130 0.07
131 0.07
132 0.06
133 0.07
134 0.1
135 0.13
136 0.16
137 0.2
138 0.25
139 0.3
140 0.38
141 0.37
142 0.36
143 0.43
144 0.45
145 0.42
146 0.4
147 0.42
148 0.45
149 0.51
150 0.53
151 0.45
152 0.47
153 0.46
154 0.45
155 0.45
156 0.36
157 0.33
158 0.35
159 0.36
160 0.3
161 0.31
162 0.36
163 0.32
164 0.32
165 0.29
166 0.27
167 0.23
168 0.27
169 0.27