Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

D8PLH8

Protein Details
Accession D8PLH8    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
154-185MGPHKNKKPYTISKGRKFERARGRRKSRGFKVBasic
NLS Segment(s)
PositionSequence
141-185GKKTAREANKHFGMGPHKNKKPYTISKGRKFERARGRRKSRGFKV
Subcellular Location(s) cyto 11, cyto_nucl 10, nucl 7, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR036227  L18e/L15P_sf  
IPR000039  Ribosomal_L18e  
IPR021131  Ribosomal_L18e/L15P  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG scm:SCHCO_02624450  -  
Pfam View protein in Pfam  
PF17135  Ribosomal_L18  
Amino Acid Sequences MGIDLTAHHVKKGQRTAPKSEDPYLLLLVKLYRFLARRTDAPFNKVILHRLFLSKINRPPVSLSKIFVETQKAELEGKIVVIVGTVTDDNRMLEVPKATIAALRFTRSAKERILKAGGETITLDQLALRAPTGANTILLRGKKTAREANKHFGMGPHKNKKPYTISKGRKFERARGRRKSRGFKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.56
3 0.65
4 0.68
5 0.72
6 0.69
7 0.64
8 0.59
9 0.51
10 0.48
11 0.41
12 0.34
13 0.25
14 0.2
15 0.18
16 0.15
17 0.15
18 0.14
19 0.16
20 0.17
21 0.19
22 0.25
23 0.27
24 0.31
25 0.35
26 0.44
27 0.42
28 0.45
29 0.45
30 0.39
31 0.41
32 0.38
33 0.37
34 0.29
35 0.28
36 0.26
37 0.25
38 0.26
39 0.26
40 0.3
41 0.32
42 0.36
43 0.41
44 0.4
45 0.39
46 0.42
47 0.42
48 0.44
49 0.38
50 0.34
51 0.29
52 0.31
53 0.31
54 0.28
55 0.25
56 0.19
57 0.2
58 0.19
59 0.17
60 0.15
61 0.14
62 0.13
63 0.1
64 0.08
65 0.06
66 0.06
67 0.04
68 0.04
69 0.04
70 0.03
71 0.03
72 0.04
73 0.03
74 0.04
75 0.04
76 0.04
77 0.05
78 0.05
79 0.05
80 0.06
81 0.06
82 0.06
83 0.06
84 0.07
85 0.06
86 0.08
87 0.08
88 0.11
89 0.11
90 0.13
91 0.13
92 0.14
93 0.17
94 0.18
95 0.21
96 0.22
97 0.26
98 0.26
99 0.29
100 0.31
101 0.28
102 0.25
103 0.27
104 0.22
105 0.18
106 0.17
107 0.14
108 0.11
109 0.11
110 0.1
111 0.05
112 0.06
113 0.06
114 0.05
115 0.05
116 0.05
117 0.05
118 0.06
119 0.08
120 0.08
121 0.09
122 0.09
123 0.11
124 0.15
125 0.16
126 0.17
127 0.18
128 0.21
129 0.24
130 0.3
131 0.37
132 0.42
133 0.5
134 0.56
135 0.62
136 0.62
137 0.59
138 0.53
139 0.49
140 0.49
141 0.49
142 0.53
143 0.55
144 0.57
145 0.64
146 0.64
147 0.67
148 0.68
149 0.68
150 0.68
151 0.69
152 0.73
153 0.76
154 0.85
155 0.81
156 0.81
157 0.76
158 0.76
159 0.76
160 0.76
161 0.77
162 0.78
163 0.84
164 0.84
165 0.9