Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

D8PL08

Protein Details
Accession D8PL08    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
366-386KGVFSSPKKEEKKGKEKTESKBasic
NLS Segment(s)
PositionSequence
370-386SSPKKEEKKGKEKTESK
Subcellular Location(s) cyto 18.5, cyto_nucl 11.833, mito_nucl 4.333, nucl 4, mito 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR032640  AMPK1_CBM  
IPR013783  Ig-like_fold  
IPR014756  Ig_E-set  
KEGG scm:SCHCO_02624214  -  
Pfam View protein in Pfam  
PF16561  AMPK1_CBM  
CDD cd02859  E_set_AMPKbeta_like_N  
Amino Acid Sequences MTDTHEVVFRWPRTEPNEVIATGTFDQWSCSLRLTKGAEGFEGRARVPWGEKITYKFVVDGQWVTDNAQPTEWDNAGNLNNVYTAPAKPEPQPEAEPAPKSTPAPAPAAAAEPAPTVNGIEKHEADVVEDAPPAVPAAIENVKVEEVAPVVPVPILPVTAPETTTAAEVVPQAAVEASPAPAVEEKATPEEQPSTHEPAPTPVEAVPAPAEAAASEPTPEPTPAVEEAKDTAATPVPAAETPTPATPTPATPTPAAEPSVPAEPSTPPPPPPVNGTNGTSGSPAEEKKEPVTPVKNGKQRFSSEQSTSPSSPASSTSRFSSARKKRGSVFGTVKGSSSPSEPGSPDSTIKASSMRKKRTSIFGSLKGVFSSPKKEEKKGKEKTESK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.43
3 0.4
4 0.41
5 0.39
6 0.39
7 0.32
8 0.31
9 0.24
10 0.23
11 0.18
12 0.14
13 0.16
14 0.15
15 0.17
16 0.14
17 0.17
18 0.2
19 0.2
20 0.28
21 0.3
22 0.34
23 0.36
24 0.36
25 0.35
26 0.33
27 0.35
28 0.31
29 0.3
30 0.25
31 0.22
32 0.23
33 0.22
34 0.23
35 0.27
36 0.28
37 0.3
38 0.33
39 0.36
40 0.4
41 0.41
42 0.38
43 0.33
44 0.3
45 0.28
46 0.27
47 0.23
48 0.2
49 0.2
50 0.2
51 0.21
52 0.22
53 0.22
54 0.2
55 0.2
56 0.18
57 0.17
58 0.21
59 0.19
60 0.17
61 0.14
62 0.17
63 0.18
64 0.19
65 0.17
66 0.13
67 0.13
68 0.13
69 0.14
70 0.12
71 0.11
72 0.15
73 0.17
74 0.19
75 0.22
76 0.29
77 0.3
78 0.32
79 0.34
80 0.33
81 0.37
82 0.39
83 0.38
84 0.35
85 0.35
86 0.32
87 0.3
88 0.3
89 0.27
90 0.26
91 0.26
92 0.24
93 0.22
94 0.21
95 0.22
96 0.19
97 0.15
98 0.12
99 0.1
100 0.09
101 0.08
102 0.07
103 0.06
104 0.08
105 0.1
106 0.12
107 0.15
108 0.15
109 0.17
110 0.18
111 0.18
112 0.16
113 0.15
114 0.13
115 0.11
116 0.1
117 0.09
118 0.07
119 0.07
120 0.06
121 0.05
122 0.04
123 0.03
124 0.07
125 0.08
126 0.09
127 0.09
128 0.1
129 0.1
130 0.1
131 0.1
132 0.07
133 0.06
134 0.06
135 0.06
136 0.05
137 0.05
138 0.05
139 0.05
140 0.05
141 0.05
142 0.05
143 0.04
144 0.06
145 0.09
146 0.09
147 0.09
148 0.09
149 0.1
150 0.1
151 0.1
152 0.09
153 0.06
154 0.06
155 0.06
156 0.06
157 0.05
158 0.04
159 0.04
160 0.04
161 0.04
162 0.03
163 0.04
164 0.04
165 0.04
166 0.04
167 0.04
168 0.05
169 0.06
170 0.06
171 0.06
172 0.07
173 0.1
174 0.11
175 0.11
176 0.11
177 0.12
178 0.11
179 0.15
180 0.17
181 0.21
182 0.21
183 0.22
184 0.21
185 0.22
186 0.25
187 0.21
188 0.19
189 0.13
190 0.13
191 0.12
192 0.13
193 0.1
194 0.07
195 0.07
196 0.06
197 0.06
198 0.04
199 0.05
200 0.05
201 0.05
202 0.05
203 0.06
204 0.07
205 0.08
206 0.08
207 0.08
208 0.07
209 0.09
210 0.11
211 0.12
212 0.11
213 0.11
214 0.12
215 0.13
216 0.13
217 0.11
218 0.1
219 0.09
220 0.09
221 0.08
222 0.07
223 0.08
224 0.08
225 0.1
226 0.09
227 0.1
228 0.11
229 0.12
230 0.14
231 0.13
232 0.15
233 0.14
234 0.15
235 0.17
236 0.18
237 0.2
238 0.18
239 0.2
240 0.2
241 0.21
242 0.21
243 0.17
244 0.15
245 0.15
246 0.18
247 0.16
248 0.14
249 0.13
250 0.14
251 0.17
252 0.21
253 0.21
254 0.19
255 0.24
256 0.26
257 0.26
258 0.3
259 0.3
260 0.31
261 0.32
262 0.33
263 0.31
264 0.3
265 0.29
266 0.24
267 0.2
268 0.17
269 0.17
270 0.15
271 0.16
272 0.18
273 0.19
274 0.21
275 0.26
276 0.26
277 0.31
278 0.35
279 0.38
280 0.45
281 0.52
282 0.57
283 0.55
284 0.58
285 0.57
286 0.57
287 0.58
288 0.55
289 0.53
290 0.49
291 0.51
292 0.5
293 0.5
294 0.46
295 0.4
296 0.34
297 0.28
298 0.25
299 0.24
300 0.25
301 0.22
302 0.23
303 0.25
304 0.3
305 0.32
306 0.35
307 0.42
308 0.47
309 0.54
310 0.58
311 0.59
312 0.59
313 0.67
314 0.66
315 0.64
316 0.61
317 0.6
318 0.58
319 0.55
320 0.49
321 0.4
322 0.39
323 0.3
324 0.26
325 0.21
326 0.18
327 0.21
328 0.21
329 0.24
330 0.26
331 0.27
332 0.27
333 0.26
334 0.25
335 0.23
336 0.23
337 0.26
338 0.3
339 0.38
340 0.47
341 0.54
342 0.58
343 0.64
344 0.69
345 0.73
346 0.7
347 0.71
348 0.69
349 0.67
350 0.68
351 0.64
352 0.59
353 0.49
354 0.44
355 0.39
356 0.34
357 0.35
358 0.34
359 0.42
360 0.47
361 0.55
362 0.64
363 0.71
364 0.77
365 0.79
366 0.84