Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D8QFU4

Protein Details
Accession D8QFU4   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
107-134ETPNDLPGKRPTRRRQPSRRVGAPHLVSHydrophilic
NLS Segment(s)
PositionSequence
115-126KRPTRRRQPSRR
Subcellular Location(s) nucl 18.5, cyto_nucl 13, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016197  Chromo-like_dom_sf  
KEGG scm:SCHCO_01104154  -  
Amino Acid Sequences ETSTYELDLPDALKARRIHPVFHVSLLRPHDPNNDILFPNQDFTKHYDFGAPNNAEFLVSSIKSHRWDGEKLLFSVVWDYGDITEEPLSNVEELSALDDYLALCGVETPNDLPGKRPTRRRQPSRRVGAPHLVSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.25
3 0.34
4 0.35
5 0.35
6 0.36
7 0.44
8 0.39
9 0.42
10 0.43
11 0.34
12 0.39
13 0.41
14 0.38
15 0.32
16 0.32
17 0.33
18 0.31
19 0.34
20 0.32
21 0.3
22 0.27
23 0.27
24 0.28
25 0.23
26 0.23
27 0.19
28 0.15
29 0.14
30 0.18
31 0.23
32 0.2
33 0.2
34 0.24
35 0.24
36 0.25
37 0.32
38 0.28
39 0.22
40 0.22
41 0.22
42 0.16
43 0.15
44 0.14
45 0.08
46 0.08
47 0.09
48 0.09
49 0.12
50 0.14
51 0.15
52 0.16
53 0.17
54 0.18
55 0.21
56 0.26
57 0.25
58 0.24
59 0.24
60 0.21
61 0.18
62 0.18
63 0.14
64 0.08
65 0.06
66 0.06
67 0.05
68 0.07
69 0.07
70 0.07
71 0.07
72 0.07
73 0.07
74 0.08
75 0.08
76 0.07
77 0.07
78 0.06
79 0.05
80 0.05
81 0.07
82 0.06
83 0.06
84 0.05
85 0.06
86 0.06
87 0.06
88 0.06
89 0.04
90 0.03
91 0.04
92 0.05
93 0.05
94 0.07
95 0.07
96 0.11
97 0.15
98 0.15
99 0.18
100 0.27
101 0.36
102 0.42
103 0.52
104 0.58
105 0.66
106 0.78
107 0.85
108 0.87
109 0.89
110 0.93
111 0.93
112 0.91
113 0.87
114 0.83
115 0.81