Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

D8PP52

Protein Details
Accession D8PP52    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
70-96NTYHVRSRRYRLGRRVRPGPRRGAHRPBasic
NLS Segment(s)
PositionSequence
76-97SRRYRLGRRVRPGPRRGAHRPW
Subcellular Location(s) nucl 22.5, cyto_nucl 14.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018824  Conidiation-specific_6  
Pfam View protein in Pfam  
PF10346  Con-6  
Amino Acid Sequences MYAENNTHKNPERVAAGYKGTLNNPNAGQEAKENASQRLREHGEDQPRASIGRSSSGLGRLSRSLYQSHNTYHVRSRRYRLGRRVRPGPRRGAHRPW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.33
3 0.3
4 0.28
5 0.29
6 0.27
7 0.26
8 0.29
9 0.26
10 0.26
11 0.25
12 0.25
13 0.23
14 0.22
15 0.2
16 0.15
17 0.17
18 0.16
19 0.19
20 0.19
21 0.21
22 0.24
23 0.25
24 0.24
25 0.28
26 0.29
27 0.27
28 0.29
29 0.31
30 0.35
31 0.36
32 0.36
33 0.29
34 0.27
35 0.25
36 0.22
37 0.18
38 0.11
39 0.11
40 0.12
41 0.12
42 0.12
43 0.15
44 0.17
45 0.15
46 0.16
47 0.15
48 0.17
49 0.18
50 0.19
51 0.18
52 0.19
53 0.22
54 0.24
55 0.24
56 0.29
57 0.29
58 0.31
59 0.36
60 0.4
61 0.43
62 0.46
63 0.51
64 0.54
65 0.62
66 0.69
67 0.72
68 0.77
69 0.8
70 0.83
71 0.87
72 0.87
73 0.87
74 0.85
75 0.85
76 0.81
77 0.8