Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D8PKC0

Protein Details
Accession D8PKC0    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
154-184QRVKALERANKERQKREKMYRSQLKKSRSARHydrophilic
NLS Segment(s)
PositionSequence
156-185VKALERANKERQKREKMYRSQLKKSRSARP
Subcellular Location(s) mito 24, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000352  Pep_chain_release_fac_I  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003747  F:translation release factor activity  
KEGG scm:SCHCO_02623710  -  
Pfam View protein in Pfam  
PF00472  RF-1  
Amino Acid Sequences MRAAWTLRPAWSPPTFRLACSLAKPPPHRALIEQEQMNDAKRWVQDFKSVEIPRNLVDITFSRSSGPGGQNVNKVNTKATLRCSVTSSWIPQWAGARLRESPHYVRATDSILLTSTAHRSQAQNIEECMRKLHNVIETASSADIRNEASPEQKQRVKALERANKERQKREKMYRSQLKKSRSARPD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.42
3 0.39
4 0.42
5 0.38
6 0.35
7 0.34
8 0.38
9 0.34
10 0.42
11 0.45
12 0.48
13 0.52
14 0.51
15 0.49
16 0.45
17 0.49
18 0.49
19 0.52
20 0.46
21 0.4
22 0.39
23 0.38
24 0.37
25 0.29
26 0.22
27 0.18
28 0.18
29 0.21
30 0.22
31 0.22
32 0.28
33 0.29
34 0.32
35 0.38
36 0.38
37 0.38
38 0.37
39 0.37
40 0.29
41 0.29
42 0.26
43 0.15
44 0.16
45 0.13
46 0.17
47 0.16
48 0.16
49 0.15
50 0.15
51 0.16
52 0.19
53 0.19
54 0.17
55 0.2
56 0.23
57 0.27
58 0.28
59 0.31
60 0.28
61 0.27
62 0.24
63 0.23
64 0.24
65 0.21
66 0.23
67 0.26
68 0.27
69 0.27
70 0.28
71 0.26
72 0.27
73 0.26
74 0.25
75 0.19
76 0.2
77 0.19
78 0.18
79 0.19
80 0.18
81 0.19
82 0.17
83 0.18
84 0.16
85 0.18
86 0.19
87 0.22
88 0.2
89 0.24
90 0.25
91 0.23
92 0.23
93 0.23
94 0.22
95 0.19
96 0.17
97 0.12
98 0.1
99 0.1
100 0.1
101 0.1
102 0.11
103 0.1
104 0.12
105 0.13
106 0.14
107 0.17
108 0.24
109 0.25
110 0.24
111 0.25
112 0.27
113 0.28
114 0.27
115 0.25
116 0.19
117 0.18
118 0.17
119 0.19
120 0.19
121 0.19
122 0.2
123 0.2
124 0.2
125 0.2
126 0.19
127 0.17
128 0.13
129 0.11
130 0.11
131 0.1
132 0.1
133 0.11
134 0.11
135 0.15
136 0.21
137 0.27
138 0.34
139 0.37
140 0.39
141 0.42
142 0.49
143 0.49
144 0.51
145 0.55
146 0.56
147 0.6
148 0.66
149 0.72
150 0.72
151 0.76
152 0.79
153 0.79
154 0.81
155 0.82
156 0.85
157 0.85
158 0.87
159 0.89
160 0.9
161 0.89
162 0.89
163 0.87
164 0.83
165 0.82
166 0.79