Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D8PT71

Protein Details
Accession D8PT71    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
93-125TEKRCARCGVKVKKPKKEKKPKEPKEPKSDAAQBasic
NLS Segment(s)
PositionSequence
103-120KVKKPKKEKKPKEPKEPK
Subcellular Location(s) cyto 10.5, cyto_nucl 9.5, nucl 7.5, mito 4, pero 2, E.R. 2
Family & Domain DBs
Amino Acid Sequences MNSKPVEMATHQPAAAYDTPPAYPQPQGQQPVHLHPPPPQQMTAAQVGEQYRAELFAQCAQGVHDPKTKYGVCGIITAVLCFPCGLICLFLDTEKRCARCGVKVKKPKKEKKPKEPKEPKSDAAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.26
3 0.21
4 0.17
5 0.16
6 0.17
7 0.18
8 0.19
9 0.16
10 0.17
11 0.19
12 0.24
13 0.29
14 0.35
15 0.34
16 0.4
17 0.4
18 0.44
19 0.48
20 0.43
21 0.37
22 0.37
23 0.45
24 0.43
25 0.43
26 0.37
27 0.32
28 0.31
29 0.33
30 0.31
31 0.23
32 0.17
33 0.17
34 0.17
35 0.17
36 0.15
37 0.12
38 0.08
39 0.09
40 0.09
41 0.08
42 0.08
43 0.1
44 0.11
45 0.1
46 0.1
47 0.1
48 0.14
49 0.15
50 0.17
51 0.18
52 0.18
53 0.19
54 0.24
55 0.23
56 0.2
57 0.2
58 0.2
59 0.16
60 0.17
61 0.16
62 0.15
63 0.15
64 0.14
65 0.13
66 0.1
67 0.09
68 0.08
69 0.08
70 0.04
71 0.05
72 0.05
73 0.05
74 0.05
75 0.07
76 0.08
77 0.09
78 0.14
79 0.14
80 0.21
81 0.25
82 0.26
83 0.25
84 0.3
85 0.31
86 0.36
87 0.45
88 0.49
89 0.55
90 0.64
91 0.73
92 0.79
93 0.87
94 0.89
95 0.9
96 0.91
97 0.92
98 0.93
99 0.95
100 0.95
101 0.95
102 0.96
103 0.95
104 0.94
105 0.9