Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D8PT37

Protein Details
Accession D8PT37   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
253-274FLKSPPPGRRGRRVTQATKETPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto 5, extr 3
Family & Domain DBs
KEGG scm:SCHCO_02742534  -  
Amino Acid Sequences MPALNREKPADIIPPADILAANASLGSSPLVKRLGLPSMPGEVSPPLPKTPRTPKSANSAKSIWPHINPFRNKSQNGIPHELLDNYTGHINDAGLQTLSPGLSPPSQWHRKLSPKTPGLRPDRVQRSVRAADLPITPSADYFSTPTTAERAPPYWQPAQPSGRASVFARKRTGSECSSGRPGRSAFESMRDRPPSYSSCDSESPVCFVMDPSWTAEQGEPRFCRVSNPTDGLSGTLDAPDYLWDTPGEAHKVFLKSPPPGRRGRRVTQATKETP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.23
3 0.21
4 0.18
5 0.12
6 0.12
7 0.1
8 0.08
9 0.07
10 0.07
11 0.06
12 0.07
13 0.07
14 0.08
15 0.08
16 0.12
17 0.14
18 0.14
19 0.16
20 0.19
21 0.24
22 0.22
23 0.24
24 0.22
25 0.25
26 0.25
27 0.23
28 0.21
29 0.17
30 0.19
31 0.21
32 0.21
33 0.21
34 0.24
35 0.27
36 0.34
37 0.43
38 0.47
39 0.51
40 0.53
41 0.53
42 0.61
43 0.68
44 0.62
45 0.57
46 0.52
47 0.5
48 0.5
49 0.51
50 0.44
51 0.38
52 0.42
53 0.44
54 0.51
55 0.51
56 0.52
57 0.56
58 0.6
59 0.58
60 0.55
61 0.55
62 0.54
63 0.55
64 0.56
65 0.47
66 0.41
67 0.41
68 0.38
69 0.3
70 0.24
71 0.17
72 0.12
73 0.12
74 0.1
75 0.09
76 0.09
77 0.08
78 0.09
79 0.09
80 0.09
81 0.08
82 0.07
83 0.07
84 0.08
85 0.07
86 0.05
87 0.05
88 0.06
89 0.06
90 0.07
91 0.11
92 0.19
93 0.27
94 0.28
95 0.33
96 0.38
97 0.47
98 0.53
99 0.56
100 0.57
101 0.57
102 0.61
103 0.62
104 0.64
105 0.62
106 0.61
107 0.57
108 0.57
109 0.57
110 0.58
111 0.54
112 0.48
113 0.48
114 0.43
115 0.41
116 0.33
117 0.26
118 0.22
119 0.2
120 0.19
121 0.13
122 0.12
123 0.11
124 0.1
125 0.1
126 0.08
127 0.08
128 0.07
129 0.07
130 0.08
131 0.08
132 0.09
133 0.1
134 0.1
135 0.11
136 0.12
137 0.13
138 0.15
139 0.16
140 0.21
141 0.23
142 0.24
143 0.25
144 0.3
145 0.31
146 0.31
147 0.31
148 0.29
149 0.25
150 0.25
151 0.23
152 0.26
153 0.29
154 0.3
155 0.32
156 0.3
157 0.31
158 0.32
159 0.36
160 0.3
161 0.29
162 0.27
163 0.28
164 0.35
165 0.35
166 0.33
167 0.31
168 0.29
169 0.26
170 0.27
171 0.27
172 0.2
173 0.27
174 0.32
175 0.32
176 0.4
177 0.41
178 0.4
179 0.38
180 0.41
181 0.35
182 0.37
183 0.39
184 0.33
185 0.33
186 0.33
187 0.34
188 0.33
189 0.31
190 0.26
191 0.22
192 0.2
193 0.15
194 0.15
195 0.14
196 0.12
197 0.12
198 0.14
199 0.14
200 0.14
201 0.15
202 0.16
203 0.21
204 0.24
205 0.3
206 0.28
207 0.31
208 0.32
209 0.31
210 0.35
211 0.34
212 0.36
213 0.35
214 0.38
215 0.35
216 0.35
217 0.35
218 0.31
219 0.27
220 0.21
221 0.15
222 0.11
223 0.1
224 0.09
225 0.09
226 0.08
227 0.09
228 0.09
229 0.09
230 0.09
231 0.1
232 0.12
233 0.17
234 0.21
235 0.18
236 0.2
237 0.25
238 0.27
239 0.27
240 0.3
241 0.32
242 0.35
243 0.45
244 0.52
245 0.53
246 0.61
247 0.68
248 0.73
249 0.75
250 0.75
251 0.77
252 0.78
253 0.8
254 0.81