Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D8QDG9

Protein Details
Accession D8QDG9   
Localization Confidence Low
Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-33VNIPKTRRTYCKGKACKKHTPHKVTQYKKGKDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, cyto_nucl 9.5, mito 9, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG scm:SCHCO_02588193  -  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNIPKTRRTYCKGKACKKHTPHKVTQYKKGKDSIFAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECTSCKYKMQLPLKRCKHFELGGEKKTKGAALQF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.83
3 0.83
4 0.87
5 0.86
6 0.87
7 0.87
8 0.85
9 0.84
10 0.84
11 0.86
12 0.83
13 0.84
14 0.84
15 0.79
16 0.75
17 0.72
18 0.62
19 0.56
20 0.53
21 0.53
22 0.52
23 0.5
24 0.53
25 0.52
26 0.56
27 0.58
28 0.6
29 0.55
30 0.56
31 0.61
32 0.59
33 0.61
34 0.59
35 0.58
36 0.57
37 0.59
38 0.5
39 0.45
40 0.41
41 0.33
42 0.35
43 0.37
44 0.35
45 0.3
46 0.37
47 0.41
48 0.5
49 0.58
50 0.61
51 0.61
52 0.64
53 0.71
54 0.72
55 0.7
56 0.67
57 0.63
58 0.6
59 0.59
60 0.54
61 0.49
62 0.45
63 0.4
64 0.35
65 0.33
66 0.34
67 0.38
68 0.45
69 0.49
70 0.52
71 0.62
72 0.69
73 0.74
74 0.72
75 0.67
76 0.64
77 0.59
78 0.59
79 0.59
80 0.59
81 0.59
82 0.61
83 0.56
84 0.51
85 0.48
86 0.42