Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0URN4

Protein Details
Accession Q0URN4    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
2-21SEHLRNSPQRRTRRLPHVPLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto_nucl 10.5, mito 8
Family & Domain DBs
KEGG pno:SNOG_05580  -  
Amino Acid Sequences MSEHLRNSPQRRTRRLPHVPLAPQLTEQGDHTAHSTTLATIYTILTSHQLNRHHSYILAAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.82
3 0.79
4 0.78
5 0.77
6 0.71
7 0.67
8 0.61
9 0.51
10 0.41
11 0.35
12 0.27
13 0.2
14 0.17
15 0.14
16 0.11
17 0.11
18 0.11
19 0.1
20 0.09
21 0.09
22 0.09
23 0.06
24 0.07
25 0.07
26 0.06
27 0.06
28 0.06
29 0.06
30 0.06
31 0.06
32 0.08
33 0.09
34 0.13
35 0.18
36 0.23
37 0.29
38 0.35
39 0.36
40 0.36
41 0.35