Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

D8PP00

Protein Details
Accession D8PP00    Localization Confidence High Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
81-122PLDLRPKRTRAIRRRMTKHELSLKTLKQTKREQNFPRRKYALHydrophilic
NLS Segment(s)
PositionSequence
84-112LRPKRTRAIRRRMTKHELSLKTLKQTKRE
117-118RR
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
KEGG scm:SCHCO_02621464  -  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MSGRVKAYELQSKSKNDLSKQLLELKNELLTLRVQKIAGGSASKLTKINTVRKSIARVMTVMNHKARQNTREFYKGKKYLPLDLRPKRTRAIRRRMTKHELSLKTLKQTKREQNFPRRKYALKAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.53
3 0.47
4 0.52
5 0.5
6 0.49
7 0.48
8 0.53
9 0.5
10 0.47
11 0.46
12 0.38
13 0.33
14 0.28
15 0.25
16 0.16
17 0.15
18 0.17
19 0.17
20 0.17
21 0.16
22 0.16
23 0.16
24 0.16
25 0.15
26 0.12
27 0.11
28 0.13
29 0.14
30 0.14
31 0.15
32 0.14
33 0.19
34 0.24
35 0.32
36 0.32
37 0.37
38 0.39
39 0.4
40 0.43
41 0.41
42 0.39
43 0.31
44 0.27
45 0.23
46 0.25
47 0.26
48 0.26
49 0.23
50 0.23
51 0.24
52 0.29
53 0.31
54 0.3
55 0.33
56 0.33
57 0.35
58 0.41
59 0.41
60 0.4
61 0.48
62 0.49
63 0.45
64 0.47
65 0.46
66 0.46
67 0.51
68 0.55
69 0.56
70 0.58
71 0.67
72 0.64
73 0.64
74 0.62
75 0.64
76 0.66
77 0.65
78 0.68
79 0.68
80 0.75
81 0.81
82 0.84
83 0.83
84 0.79
85 0.77
86 0.76
87 0.69
88 0.66
89 0.65
90 0.59
91 0.6
92 0.61
93 0.56
94 0.54
95 0.61
96 0.65
97 0.66
98 0.74
99 0.75
100 0.79
101 0.86
102 0.83
103 0.84
104 0.79
105 0.74