Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D8QIB0

Protein Details
Accession D8QIB0   
Localization Confidence Low
Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
129-159SSQRACRPERFGCRRRWTRPRWSVTHVKWNPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16.5, mito_nucl 11, nucl 4.5, cyto 4
Family & Domain DBs
Amino Acid Sequences LVFKRVRVTCKRFDRVVSPLQTRRASIRIAIRRVIAHNQADGSFLRSESANPVVEGLRRAFRTTATTAWSCVVPAFWRNCQGAKLGHKRPSNVHTVVIDRAILIKGCIFRGRAQCSRYTTSKSNSPNFSSQRACRPERFGCRRRWTRPRWSVTHVKWNP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.6
3 0.61
4 0.58
5 0.56
6 0.55
7 0.59
8 0.56
9 0.52
10 0.5
11 0.45
12 0.39
13 0.36
14 0.4
15 0.41
16 0.43
17 0.43
18 0.41
19 0.4
20 0.42
21 0.42
22 0.39
23 0.32
24 0.3
25 0.29
26 0.27
27 0.26
28 0.22
29 0.2
30 0.14
31 0.12
32 0.12
33 0.11
34 0.11
35 0.13
36 0.16
37 0.13
38 0.12
39 0.14
40 0.14
41 0.14
42 0.16
43 0.14
44 0.15
45 0.15
46 0.17
47 0.16
48 0.16
49 0.2
50 0.2
51 0.2
52 0.19
53 0.19
54 0.18
55 0.19
56 0.18
57 0.13
58 0.11
59 0.1
60 0.07
61 0.11
62 0.13
63 0.13
64 0.17
65 0.18
66 0.18
67 0.19
68 0.2
69 0.2
70 0.26
71 0.34
72 0.36
73 0.43
74 0.45
75 0.46
76 0.48
77 0.47
78 0.45
79 0.38
80 0.34
81 0.27
82 0.27
83 0.26
84 0.22
85 0.18
86 0.12
87 0.11
88 0.1
89 0.08
90 0.07
91 0.08
92 0.08
93 0.1
94 0.12
95 0.13
96 0.18
97 0.25
98 0.32
99 0.35
100 0.37
101 0.41
102 0.44
103 0.48
104 0.47
105 0.46
106 0.44
107 0.44
108 0.49
109 0.51
110 0.53
111 0.52
112 0.53
113 0.55
114 0.54
115 0.55
116 0.54
117 0.51
118 0.54
119 0.56
120 0.57
121 0.53
122 0.57
123 0.6
124 0.64
125 0.71
126 0.69
127 0.72
128 0.78
129 0.83
130 0.86
131 0.87
132 0.85
133 0.86
134 0.89
135 0.87
136 0.83
137 0.81
138 0.82
139 0.78