Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D8PV23

Protein Details
Accession D8PV23   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
106-129RSDLAVRRRRSRSRLCVRRRALVLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 10, mito 7, cyto 5.5
Family & Domain DBs
KEGG scm:SCHCO_02526683  -  
Amino Acid Sequences MRERPPRRALTSDSAPYASDSARLHAQTRQKHFLSGFCVPPTTPKTAFLLSTCSSKPGFKPSHEDLGDFGPLGNGFELRTTSSGLRQRAQGFDGDFKPSNADFDFRSDLAVRRRRSRSRLCVRRRALVLKPDSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.4
3 0.36
4 0.31
5 0.23
6 0.2
7 0.16
8 0.17
9 0.2
10 0.21
11 0.22
12 0.26
13 0.33
14 0.37
15 0.44
16 0.49
17 0.45
18 0.48
19 0.47
20 0.45
21 0.43
22 0.39
23 0.35
24 0.28
25 0.28
26 0.24
27 0.29
28 0.29
29 0.28
30 0.24
31 0.23
32 0.25
33 0.26
34 0.27
35 0.21
36 0.23
37 0.19
38 0.21
39 0.2
40 0.19
41 0.18
42 0.19
43 0.19
44 0.23
45 0.25
46 0.24
47 0.31
48 0.32
49 0.39
50 0.38
51 0.37
52 0.3
53 0.28
54 0.26
55 0.19
56 0.15
57 0.07
58 0.07
59 0.07
60 0.06
61 0.04
62 0.04
63 0.04
64 0.05
65 0.06
66 0.07
67 0.08
68 0.09
69 0.14
70 0.2
71 0.22
72 0.24
73 0.27
74 0.29
75 0.29
76 0.29
77 0.26
78 0.22
79 0.24
80 0.24
81 0.25
82 0.23
83 0.22
84 0.24
85 0.21
86 0.22
87 0.18
88 0.18
89 0.14
90 0.18
91 0.22
92 0.18
93 0.21
94 0.2
95 0.24
96 0.32
97 0.39
98 0.4
99 0.46
100 0.55
101 0.61
102 0.69
103 0.75
104 0.76
105 0.8
106 0.85
107 0.86
108 0.88
109 0.84
110 0.84
111 0.8
112 0.76
113 0.72
114 0.71