Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D8PT10

Protein Details
Accession D8PT10   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MGKRKKSSKKPAPNAARRKQPLDBasic
NLS Segment(s)
PositionSequence
3-19KRKKSSKKPAPNAARRK
Subcellular Location(s) nucl 18.5, cyto_nucl 10, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
KEGG scm:SCHCO_02605233  -  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKKSSKKPAPNAARRKQPLDTTFTCLFCHHDNSVTVRMDKKDGVAYLSCKVCDQRYQGKVNHLTEPIDIYAEWMDACDAAQDEAPPPRPTASSSRPRAPPQRAEISDSDDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.9
3 0.9
4 0.84
5 0.79
6 0.73
7 0.7
8 0.64
9 0.61
10 0.55
11 0.51
12 0.5
13 0.46
14 0.41
15 0.33
16 0.33
17 0.27
18 0.28
19 0.22
20 0.21
21 0.22
22 0.25
23 0.3
24 0.28
25 0.27
26 0.26
27 0.26
28 0.25
29 0.24
30 0.21
31 0.18
32 0.16
33 0.17
34 0.15
35 0.16
36 0.18
37 0.18
38 0.17
39 0.15
40 0.16
41 0.15
42 0.18
43 0.21
44 0.25
45 0.3
46 0.35
47 0.37
48 0.42
49 0.47
50 0.46
51 0.44
52 0.36
53 0.32
54 0.27
55 0.26
56 0.19
57 0.14
58 0.11
59 0.09
60 0.08
61 0.07
62 0.07
63 0.05
64 0.05
65 0.05
66 0.05
67 0.04
68 0.04
69 0.05
70 0.05
71 0.06
72 0.08
73 0.12
74 0.17
75 0.17
76 0.18
77 0.19
78 0.2
79 0.23
80 0.29
81 0.34
82 0.4
83 0.46
84 0.53
85 0.58
86 0.65
87 0.72
88 0.71
89 0.71
90 0.69
91 0.72
92 0.67
93 0.66
94 0.6