Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D8PKL0

Protein Details
Accession D8PKL0   
Localization Confidence High
Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
25-54PAAPPPSAPAKKKKKDKKRKREATPDETPABasic
84-105ASAPPKPKKKSKPSADDEKFKDBasic
NLS Segment(s)
PositionSequence
15-47KGKGKGKAPAPAAPPPSAPAKKKKKDKKRKREA
82-104PGASAPPKPKKKSKPSADDEKFK
Subcellular Location(s) nucl 15, mito_nucl 11.333, cyto_nucl 10.333, mito 6.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013885  DUF1764_euk  
KEGG scm:SCHCO_02609899  -  
Pfam View protein in Pfam  
PF08576  DUF1764  
Amino Acid Sequences MAKADDIEAIFASSKGKGKGKAPAPAAPPPSAPAKKKKKDKKRKREATPDETPAPAPPTKKRVVETVVDPSSTKPSTTTAKPGASAPPKPKKKSKPSADDEKFKDSKGTRSRRQTEEGWAVYKVDELGIDETAGDTPLCPFDCQCCF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.2
3 0.25
4 0.28
5 0.31
6 0.39
7 0.44
8 0.49
9 0.49
10 0.5
11 0.5
12 0.52
13 0.52
14 0.45
15 0.39
16 0.34
17 0.39
18 0.39
19 0.4
20 0.44
21 0.51
22 0.59
23 0.7
24 0.78
25 0.81
26 0.86
27 0.92
28 0.93
29 0.94
30 0.95
31 0.94
32 0.95
33 0.93
34 0.9
35 0.86
36 0.8
37 0.7
38 0.6
39 0.5
40 0.4
41 0.34
42 0.27
43 0.23
44 0.22
45 0.26
46 0.3
47 0.32
48 0.33
49 0.33
50 0.34
51 0.33
52 0.32
53 0.33
54 0.29
55 0.26
56 0.25
57 0.22
58 0.23
59 0.21
60 0.18
61 0.11
62 0.13
63 0.17
64 0.18
65 0.23
66 0.22
67 0.23
68 0.24
69 0.24
70 0.28
71 0.29
72 0.32
73 0.36
74 0.42
75 0.5
76 0.54
77 0.63
78 0.66
79 0.73
80 0.78
81 0.79
82 0.79
83 0.79
84 0.85
85 0.82
86 0.8
87 0.73
88 0.71
89 0.62
90 0.52
91 0.51
92 0.42
93 0.45
94 0.47
95 0.52
96 0.53
97 0.62
98 0.69
99 0.68
100 0.71
101 0.64
102 0.63
103 0.62
104 0.55
105 0.47
106 0.4
107 0.35
108 0.3
109 0.28
110 0.2
111 0.12
112 0.09
113 0.09
114 0.1
115 0.1
116 0.09
117 0.09
118 0.09
119 0.09
120 0.1
121 0.07
122 0.06
123 0.07
124 0.11
125 0.13
126 0.13
127 0.14