Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2QMK6

Protein Details
Accession G2QMK6   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
182-204ACEIDRKRFKTDKRNKGKPYTGGBasic
NLS Segment(s)
Subcellular Location(s) plas 23, E.R. 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001104  3-oxo-5_a-steroid_4-DH_C  
IPR010721  UstE-like  
Gene Ontology GO:0016020  C:membrane  
GO:0016627  F:oxidoreductase activity, acting on the CH-CH group of donors  
GO:0006629  P:lipid metabolic process  
KEGG mtm:MYCTH_113600  -  
Pfam View protein in Pfam  
PF06966  DUF1295  
PROSITE View protein in PROSITE  
PS50244  S5A_REDUCTASE  
Amino Acid Sequences MSETKTMSEEVKEVTVTKADLKSKDFVPRGNKSSSPFNTSLYLGLRAVDCCWQYLVLSQGYGSYVIRLLRGAVIPTAAAAETGVGLIDDLGLSGFRLVLLLMNVLAAAKHFWFVLRVAEEAWTLPGAIIVGLDNIFFDTLNNFLFLCAATSATSHPSGETLSNPYLLAGFSLFVLGIGLECACEIDRKRFKTDKRNKGKPYTGGLFAVVRHPNYAAFTIWRAGLAVATSGITAGLLIATFFTWDFSNRAVPALDEYCSKRYGQMWADYKKKTRFTLIPYVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.17
4 0.21
5 0.25
6 0.29
7 0.31
8 0.34
9 0.36
10 0.38
11 0.47
12 0.44
13 0.45
14 0.48
15 0.53
16 0.54
17 0.56
18 0.55
19 0.5
20 0.57
21 0.54
22 0.53
23 0.46
24 0.44
25 0.41
26 0.38
27 0.37
28 0.29
29 0.27
30 0.2
31 0.19
32 0.18
33 0.16
34 0.16
35 0.18
36 0.16
37 0.14
38 0.15
39 0.14
40 0.13
41 0.15
42 0.17
43 0.13
44 0.13
45 0.12
46 0.11
47 0.12
48 0.12
49 0.1
50 0.07
51 0.09
52 0.09
53 0.1
54 0.09
55 0.09
56 0.1
57 0.11
58 0.11
59 0.09
60 0.09
61 0.08
62 0.08
63 0.08
64 0.06
65 0.05
66 0.04
67 0.04
68 0.03
69 0.03
70 0.03
71 0.03
72 0.03
73 0.02
74 0.03
75 0.02
76 0.02
77 0.02
78 0.02
79 0.03
80 0.03
81 0.03
82 0.03
83 0.03
84 0.03
85 0.04
86 0.04
87 0.04
88 0.04
89 0.04
90 0.04
91 0.04
92 0.04
93 0.03
94 0.04
95 0.04
96 0.04
97 0.04
98 0.05
99 0.06
100 0.07
101 0.09
102 0.09
103 0.1
104 0.09
105 0.1
106 0.1
107 0.09
108 0.09
109 0.06
110 0.05
111 0.05
112 0.04
113 0.04
114 0.03
115 0.03
116 0.03
117 0.03
118 0.03
119 0.03
120 0.03
121 0.03
122 0.03
123 0.03
124 0.03
125 0.03
126 0.04
127 0.05
128 0.05
129 0.05
130 0.05
131 0.05
132 0.05
133 0.05
134 0.04
135 0.05
136 0.04
137 0.05
138 0.06
139 0.08
140 0.08
141 0.08
142 0.08
143 0.08
144 0.08
145 0.09
146 0.09
147 0.11
148 0.11
149 0.12
150 0.11
151 0.11
152 0.1
153 0.09
154 0.09
155 0.05
156 0.04
157 0.04
158 0.04
159 0.04
160 0.03
161 0.03
162 0.03
163 0.03
164 0.03
165 0.03
166 0.03
167 0.03
168 0.03
169 0.03
170 0.07
171 0.08
172 0.18
173 0.26
174 0.29
175 0.37
176 0.44
177 0.51
178 0.6
179 0.69
180 0.7
181 0.74
182 0.82
183 0.82
184 0.84
185 0.83
186 0.77
187 0.74
188 0.67
189 0.58
190 0.49
191 0.42
192 0.34
193 0.28
194 0.28
195 0.23
196 0.2
197 0.18
198 0.18
199 0.17
200 0.18
201 0.19
202 0.14
203 0.13
204 0.14
205 0.14
206 0.14
207 0.13
208 0.11
209 0.1
210 0.09
211 0.08
212 0.07
213 0.06
214 0.06
215 0.05
216 0.05
217 0.05
218 0.04
219 0.04
220 0.03
221 0.03
222 0.03
223 0.03
224 0.03
225 0.03
226 0.04
227 0.04
228 0.06
229 0.06
230 0.08
231 0.1
232 0.12
233 0.16
234 0.16
235 0.18
236 0.17
237 0.17
238 0.2
239 0.2
240 0.19
241 0.19
242 0.23
243 0.24
244 0.26
245 0.25
246 0.24
247 0.25
248 0.31
249 0.33
250 0.38
251 0.44
252 0.51
253 0.58
254 0.62
255 0.68
256 0.69
257 0.7
258 0.65
259 0.65
260 0.63
261 0.63