Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2QGB1

Protein Details
Accession G2QGB1    Localization Confidence High Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
29-49AMKERRGRRPGPNRARERRVPBasic
51-78LSPQSPPLPSRRKPRRERNPWPMRFVQTHydrophilic
NLS Segment(s)
PositionSequence
30-69MKERRGRRPGPNRARERRVPSLSPQSPPLPSRRKPRRERN
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
KEGG mtm:MYCTH_2307606  -  
Amino Acid Sequences MTEEERARVSHCIELTQNGKGAMGDRIEAMKERRGRRPGPNRARERRVPSLSPQSPPLPSRRKPRRERNPWPMRFVQTSFSRLPVRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.28
3 0.27
4 0.26
5 0.21
6 0.21
7 0.18
8 0.18
9 0.15
10 0.13
11 0.11
12 0.1
13 0.11
14 0.11
15 0.13
16 0.14
17 0.18
18 0.24
19 0.28
20 0.36
21 0.42
22 0.46
23 0.54
24 0.63
25 0.67
26 0.71
27 0.77
28 0.78
29 0.8
30 0.81
31 0.77
32 0.74
33 0.71
34 0.65
35 0.58
36 0.53
37 0.56
38 0.52
39 0.47
40 0.43
41 0.37
42 0.36
43 0.35
44 0.39
45 0.37
46 0.41
47 0.51
48 0.58
49 0.66
50 0.74
51 0.83
52 0.86
53 0.88
54 0.92
55 0.93
56 0.93
57 0.88
58 0.85
59 0.8
60 0.75
61 0.68
62 0.59
63 0.55
64 0.49
65 0.49
66 0.43
67 0.42